BLASTX nr result
ID: Cimicifuga21_contig00009794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00009794 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264271.1| PREDICTED: uncharacterized protein LOC100256... 66 9e-10 emb|CBI25607.3| unnamed protein product [Vitis vinifera] 66 9e-10 ref|XP_002325157.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-08 ref|XP_002523537.1| structural constituent of ribosome, putative... 62 6e-08 gb|AFK36652.1| unknown [Lotus japonicus] 61 8e-08 >ref|XP_002264271.1| PREDICTED: uncharacterized protein LOC100256785 [Vitis vinifera] Length = 162 Score = 65.9 bits (159), Expect(2) = 9e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 KELHYLN*EDRLLRWLLVKHRNTKYGLEFLSE 97 KELHYLN EDRLLRWLLVKHRNTKYGLEFL+E Sbjct: 77 KELHYLNKEDRLLRWLLVKHRNTKYGLEFLNE 108 Score = 21.9 bits (45), Expect(2) = 9e-10 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 97 SEEDGQGDLGSFPRSNIY 150 +E+D + +L FPRS ++ Sbjct: 107 NEDDVRSELSKFPRSTLF 124 >emb|CBI25607.3| unnamed protein product [Vitis vinifera] Length = 156 Score = 65.9 bits (159), Expect(2) = 9e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 KELHYLN*EDRLLRWLLVKHRNTKYGLEFLSE 97 KELHYLN EDRLLRWLLVKHRNTKYGLEFL+E Sbjct: 71 KELHYLNKEDRLLRWLLVKHRNTKYGLEFLNE 102 Score = 21.9 bits (45), Expect(2) = 9e-10 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 97 SEEDGQGDLGSFPRSNIY 150 +E+D + +L FPRS ++ Sbjct: 101 NEDDVRSELSKFPRSTLF 118 >ref|XP_002325157.1| predicted protein [Populus trichocarpa] gi|222866591|gb|EEF03722.1| predicted protein [Populus trichocarpa] Length = 136 Score = 58.9 bits (141), Expect(2) = 3e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 KELHYLN*EDRLLRWLLVKHRNTKYGLEFLSE 97 KELHYLN EDRLLRWLLVKHR+ K+GLEF+ E Sbjct: 77 KELHYLNKEDRLLRWLLVKHRDIKFGLEFMDE 108 Score = 23.9 bits (50), Expect(2) = 3e-08 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 100 EEDGQGDLGSFPRSNIY 150 +EDG+ D FPR +I+ Sbjct: 110 DEDGEFDFSEFPRDSIF 126 >ref|XP_002523537.1| structural constituent of ribosome, putative [Ricinus communis] gi|223537244|gb|EEF38876.1| structural constituent of ribosome, putative [Ricinus communis] Length = 162 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 KELHYLN*EDRLLRWLLVKHRNTKYGLEFLSE 97 KELHYLN EDRLLRWLLVKHR+TKYGL+F+ E Sbjct: 77 KELHYLNKEDRLLRWLLVKHRDTKYGLDFMDE 108 >gb|AFK36652.1| unknown [Lotus japonicus] Length = 149 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 KELHYLN*EDRLLRWLLVKHRNTKYGLEFLSE 97 KELHYLN EDRLLRWLLVKHRNT +GL+FL+E Sbjct: 77 KELHYLNKEDRLLRWLLVKHRNTSFGLDFLAE 108