BLASTX nr result
ID: Cimicifuga21_contig00008732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00008732 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525344.1| xyloglucan:xyloglucosyl transferase, putativ... 87 1e-15 ref|XP_002263411.1| PREDICTED: probable xyloglucan endotransgluc... 84 1e-14 ref|XP_004170208.1| PREDICTED: probable xyloglucan endotransgluc... 83 2e-14 ref|XP_004135238.1| PREDICTED: probable xyloglucan endotransgluc... 83 2e-14 gb|ADN33843.1| xyloglucan endotransglycosylase hydrolase [Cucumi... 83 2e-14 >ref|XP_002525344.1| xyloglucan:xyloglucosyl transferase, putative [Ricinus communis] gi|223535307|gb|EEF36982.1| xyloglucan:xyloglucosyl transferase, putative [Ricinus communis] Length = 112 Score = 87.0 bits (214), Expect = 1e-15 Identities = 41/68 (60%), Positives = 50/68 (73%) Frame = +3 Query: 3 PQLKHLTELFPRLKYDQGFKEFFGGDHIKLTDNGSFVSLTLDKASGSGFVSQNDYNYGFF 182 P + LT+LF + QGF FFGG +IKL +NGS+ +L LDK+SGSG S+N Y YGFF Sbjct: 33 PNVTRLTDLFSPVSIGQGFSTFFGGSNIKLLNNGSYATLALDKSSGSGLASKNKYYYGFF 92 Query: 183 SAAIKLPA 206 SAAIKLPA Sbjct: 93 SAAIKLPA 100 >ref|XP_002263411.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Vitis vinifera] gi|296086546|emb|CBI32135.3| unnamed protein product [Vitis vinifera] Length = 313 Score = 84.0 bits (206), Expect = 1e-14 Identities = 39/68 (57%), Positives = 52/68 (76%) Frame = +3 Query: 3 PQLKHLTELFPRLKYDQGFKEFFGGDHIKLTDNGSFVSLTLDKASGSGFVSQNDYNYGFF 182 P + LT+LF L ++ GF EFFGG +I+ +NGS+ +L L+K+SGSG VSQ+ Y YGFF Sbjct: 32 PNVTRLTDLFGHLTFNHGFTEFFGGSNIQPINNGSYANLILNKSSGSGLVSQSKYYYGFF 91 Query: 183 SAAIKLPA 206 SAAIKLP+ Sbjct: 92 SAAIKLPS 99 >ref|XP_004170208.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33-like [Cucumis sativus] Length = 310 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/68 (57%), Positives = 51/68 (75%) Frame = +3 Query: 3 PQLKHLTELFPRLKYDQGFKEFFGGDHIKLTDNGSFVSLTLDKASGSGFVSQNDYNYGFF 182 P + LT+L PR+ DQ F + FG +I+L +NGS V LTLDK SG+G VS+N Y+YGFF Sbjct: 34 PSVPRLTDLVPRVSTDQCFAKIFGASNIQLRNNGSSVDLTLDKVSGAGLVSRNKYHYGFF 93 Query: 183 SAAIKLPA 206 SA+IKLP+ Sbjct: 94 SASIKLPS 101 >ref|XP_004135238.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33-like [Cucumis sativus] Length = 310 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/68 (57%), Positives = 51/68 (75%) Frame = +3 Query: 3 PQLKHLTELFPRLKYDQGFKEFFGGDHIKLTDNGSFVSLTLDKASGSGFVSQNDYNYGFF 182 P + LT+L PR+ DQ F + FG +I+L +NGS V LTLDK SG+G VS+N Y+YGFF Sbjct: 34 PSVPRLTDLVPRVSTDQCFAKIFGASNIQLRNNGSSVDLTLDKVSGAGLVSRNKYHYGFF 93 Query: 183 SAAIKLPA 206 SA+IKLP+ Sbjct: 94 SASIKLPS 101 >gb|ADN33843.1| xyloglucan endotransglycosylase hydrolase [Cucumis melo subsp. melo] Length = 310 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/68 (57%), Positives = 51/68 (75%) Frame = +3 Query: 3 PQLKHLTELFPRLKYDQGFKEFFGGDHIKLTDNGSFVSLTLDKASGSGFVSQNDYNYGFF 182 P + LT+L PR+ DQ F + FG +I+L +NGS V LTLDK SG+G VS+N Y+YGFF Sbjct: 34 PSVPRLTDLVPRVSTDQCFAKIFGASNIQLRNNGSSVDLTLDKVSGAGLVSRNKYHYGFF 93 Query: 183 SAAIKLPA 206 SA+IKLP+ Sbjct: 94 SASIKLPS 101