BLASTX nr result
ID: Cimicifuga21_contig00008653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00008653 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containi... 97 1e-22 ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containi... 94 8e-21 ref|XP_002511313.1| pentatricopeptide repeat-containing protein,... 92 1e-20 ref|XP_002321639.1| predicted protein [Populus trichocarpa] gi|2... 96 6e-19 ref|XP_002877605.1| pentatricopeptide repeat-containing protein ... 96 2e-18 >ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Glycine max] Length = 635 Score = 97.4 bits (241), Expect(2) = 1e-22 Identities = 45/53 (84%), Positives = 47/53 (88%) Frame = +1 Query: 64 YDGIHRSLTSAGRFDEAEKILETMRNAGYEPDNITYSQVVFGLCKAGRLEEAC 222 YDGIHRSLTSAG FDEAE I+ TMRNAGYEPDNITYSQ+VFGLCK R EEAC Sbjct: 374 YDGIHRSLTSAGNFDEAENIVRTMRNAGYEPDNITYSQMVFGLCKMRRFEEAC 426 Score = 33.9 bits (76), Expect(2) = 1e-22 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = +3 Query: 3 LNLVFRVVKKFEATGHTLXXX*WD 74 L+LVFRV KK+E+TGHTL +D Sbjct: 352 LDLVFRVAKKYESTGHTLSKAIYD 375 >ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] gi|449524136|ref|XP_004169079.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] Length = 632 Score = 94.0 bits (232), Expect(2) = 8e-21 Identities = 42/52 (80%), Positives = 49/52 (94%) Frame = +1 Query: 64 YDGIHRSLTSAGRFDEAEKILETMRNAGYEPDNITYSQVVFGLCKAGRLEEA 219 YDGIHRSLTS G+FD+AE I+++MRNAGYEPDN+TYSQ+VFGLCKA RLEEA Sbjct: 368 YDGIHRSLTSTGKFDDAENIVKSMRNAGYEPDNVTYSQLVFGLCKARRLEEA 419 Score = 31.2 bits (69), Expect(2) = 8e-21 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = +3 Query: 3 LNLVFRVVKKFEATGHTLXXX*WD 74 L+LV+RV KKFEATG++L +D Sbjct: 346 LSLVYRVAKKFEATGYSLSKAMYD 369 >ref|XP_002511313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550428|gb|EEF51915.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 627 Score = 92.0 bits (227), Expect(2) = 1e-20 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = +1 Query: 64 YDGIHRSLTSAGRFDEAEKILETMRNAGYEPDNITYSQVVFGLCKAGRLEEAC 222 YDGIHRSLTS G FDEA K+++ M+ AGYEPDNITYSQ+VFGLCKA RLEEAC Sbjct: 373 YDGIHRSLTSIGNFDEAAKMMKCMQTAGYEPDNITYSQLVFGLCKARRLEEAC 425 Score = 32.3 bits (72), Expect(2) = 1e-20 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = +3 Query: 3 LNLVFRVVKKFEATGHTLXXX*WD 74 LNLVFRVV K+EATG++L +D Sbjct: 351 LNLVFRVVNKYEATGNSLSKAVYD 374 >ref|XP_002321639.1| predicted protein [Populus trichocarpa] gi|222868635|gb|EEF05766.1| predicted protein [Populus trichocarpa] Length = 476 Score = 96.3 bits (238), Expect(2) = 6e-19 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +1 Query: 64 YDGIHRSLTSAGRFDEAEKILETMRNAGYEPDNITYSQVVFGLCKAGRLEEAC 222 YDG+HRS TSAG+FDEAEKI++ MR+AGYEPDNITYSQ+VFGLCK+ RLEEAC Sbjct: 222 YDGMHRSFTSAGKFDEAEKIVKAMRDAGYEPDNITYSQLVFGLCKSKRLEEAC 274 Score = 22.7 bits (47), Expect(2) = 6e-19 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 3 LNLVFRVVKKFEATGHTLXXX*WD 74 L+LV RVV ++ATG++L +D Sbjct: 200 LDLVSRVVDGYKATGNSLSKSVYD 223 >ref|XP_002877605.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297323443|gb|EFH53864.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 618 Score = 96.3 bits (238), Expect = 2e-18 Identities = 48/68 (70%), Positives = 54/68 (79%), Gaps = 2/68 (2%) Frame = +1 Query: 22 LSRSLKQPG--IPSXXYDGIHRSLTSAGRFDEAEKILETMRNAGYEPDNITYSQVVFGLC 195 +SR + G + YDGIHRSLTS GRFDEAE+I + MRNAGYEPDNITYSQ+VFGLC Sbjct: 354 VSRKYESTGKSLSKAVYDGIHRSLTSVGRFDEAEEITKAMRNAGYEPDNITYSQLVFGLC 413 Query: 196 KAGRLEEA 219 KA RLEEA Sbjct: 414 KAKRLEEA 421