BLASTX nr result
ID: Cimicifuga21_contig00008328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00008328 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004150218.1| PREDICTED: pentatricopeptide repeat-containi... 86 3e-15 ref|XP_004133952.1| PREDICTED: 60S ribosomal protein L11-2-like ... 86 3e-15 ref|XP_004133951.1| PREDICTED: 60S ribosomal protein L11-2-like ... 86 3e-15 gb|ABB29943.1| ribosomal protein L11-like protein [Solanum tuber... 86 3e-15 dbj|BAD53703.1| putative 60S ribosomal protein L11-1 [Oryza sati... 86 3e-15 >ref|XP_004150218.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Cucumis sativus] gi|449500809|ref|XP_004161200.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Cucumis sativus] Length = 926 Score = 85.9 bits (211), Expect = 3e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +1 Query: 250 VLEQLSGQAPVFSKARYTVRSFGIRRNEKIACYVTVRGEKAMML 381 VLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACYVTVRGEKAM L Sbjct: 38 VLEQLSGQSPVFSKARYTVRSFGIRRNEKIACYVTVRGEKAMQL 81 >ref|XP_004133952.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 2 [Cucumis sativus] gi|449515416|ref|XP_004164745.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 2 [Cucumis sativus] Length = 182 Score = 85.9 bits (211), Expect = 3e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +1 Query: 250 VLEQLSGQAPVFSKARYTVRSFGIRRNEKIACYVTVRGEKAMML 381 VLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACYVTVRGEKAM L Sbjct: 38 VLEQLSGQSPVFSKARYTVRSFGIRRNEKIACYVTVRGEKAMQL 81 >ref|XP_004133951.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 1 [Cucumis sativus] gi|449515414|ref|XP_004164744.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 1 [Cucumis sativus] Length = 184 Score = 85.9 bits (211), Expect = 3e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +1 Query: 250 VLEQLSGQAPVFSKARYTVRSFGIRRNEKIACYVTVRGEKAMML 381 VLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACYVTVRGEKAM L Sbjct: 40 VLEQLSGQSPVFSKARYTVRSFGIRRNEKIACYVTVRGEKAMQL 83 >gb|ABB29943.1| ribosomal protein L11-like protein [Solanum tuberosum] Length = 181 Score = 85.9 bits (211), Expect = 3e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +1 Query: 250 VLEQLSGQAPVFSKARYTVRSFGIRRNEKIACYVTVRGEKAMML 381 VLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACYVTVRGEKAM L Sbjct: 38 VLEQLSGQSPVFSKARYTVRSFGIRRNEKIACYVTVRGEKAMQL 81 >dbj|BAD53703.1| putative 60S ribosomal protein L11-1 [Oryza sativa Japonica Group] Length = 182 Score = 85.9 bits (211), Expect = 3e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +1 Query: 250 VLEQLSGQAPVFSKARYTVRSFGIRRNEKIACYVTVRGEKAMML 381 VLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACYVTVRGEKAM L Sbjct: 38 VLEQLSGQSPVFSKARYTVRSFGIRRNEKIACYVTVRGEKAMQL 81