BLASTX nr result
ID: Cimicifuga21_contig00008246
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00008246 (229 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19296.3| unnamed protein product [Vitis vinifera] 96 4e-18 gb|AFW82923.1| hypothetical protein ZEAMMB73_776594 [Zea mays] 94 2e-17 gb|AFW82922.1| hypothetical protein ZEAMMB73_776594 [Zea mays] 94 2e-17 gb|AFW82921.1| hypothetical protein ZEAMMB73_776594 [Zea mays] 94 2e-17 ref|NP_001152705.1| LOC100286346 [Zea mays] gi|195611888|gb|ACG2... 94 2e-17 >emb|CBI19296.3| unnamed protein product [Vitis vinifera] Length = 163 Score = 95.5 bits (236), Expect = 4e-18 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +2 Query: 68 LIKKMATFELYRRSTIGMCLTETLDEMVSNGTLDAELAIQVLVQFDKSMTEALE 229 +I +MATFELYRRSTIGMCLTETLDEMV NGTL ELAIQVLVQFDKSMTEALE Sbjct: 54 IIVRMATFELYRRSTIGMCLTETLDEMVQNGTLSPELAIQVLVQFDKSMTEALE 107 >gb|AFW82923.1| hypothetical protein ZEAMMB73_776594 [Zea mays] Length = 74 Score = 93.6 bits (231), Expect = 2e-17 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = +2 Query: 80 MATFELYRRSTIGMCLTETLDEMVSNGTLDAELAIQVLVQFDKSMTEALE 229 MATFELYRRSTIGMCLTETLDEMVSNGTL ELAIQVLVQFDKSMT+ALE Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMTDALE 50 >gb|AFW82922.1| hypothetical protein ZEAMMB73_776594 [Zea mays] Length = 78 Score = 93.6 bits (231), Expect = 2e-17 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = +2 Query: 80 MATFELYRRSTIGMCLTETLDEMVSNGTLDAELAIQVLVQFDKSMTEALE 229 MATFELYRRSTIGMCLTETLDEMVSNGTL ELAIQVLVQFDKSMT+ALE Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMTDALE 50 >gb|AFW82921.1| hypothetical protein ZEAMMB73_776594 [Zea mays] Length = 62 Score = 93.6 bits (231), Expect = 2e-17 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = +2 Query: 80 MATFELYRRSTIGMCLTETLDEMVSNGTLDAELAIQVLVQFDKSMTEALE 229 MATFELYRRSTIGMCLTETLDEMVSNGTL ELAIQVLVQFDKSMT+ALE Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMTDALE 50 >ref|NP_001152705.1| LOC100286346 [Zea mays] gi|195611888|gb|ACG27774.1| transcription initiation factor IIA gamma chain [Zea mays] gi|195659197|gb|ACG49066.1| transcription initiation factor IIA gamma chain [Zea mays] gi|219887343|gb|ACL54046.1| unknown [Zea mays] gi|413950271|gb|AFW82920.1| transcription initiation factor IIA gamma chain [Zea mays] Length = 106 Score = 93.6 bits (231), Expect = 2e-17 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = +2 Query: 80 MATFELYRRSTIGMCLTETLDEMVSNGTLDAELAIQVLVQFDKSMTEALE 229 MATFELYRRSTIGMCLTETLDEMVSNGTL ELAIQVLVQFDKSMT+ALE Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSNGTLSPELAIQVLVQFDKSMTDALE 50