BLASTX nr result
ID: Cimicifuga21_contig00008008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00008008 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15967.3| unnamed protein product [Vitis vinifera] 65 6e-09 ref|XP_002279272.1| PREDICTED: 2-methylbutanal oxime monooxygena... 65 6e-09 emb|CAN80448.1| hypothetical protein VITISV_039229 [Vitis vinifera] 65 6e-09 dbj|BAF98468.1| cytochrome P450 [Coptis japonica var. dissecta] 64 2e-08 gb|AFK73716.1| cytochrome P450 [Papaver somniferum] 60 2e-07 >emb|CBI15967.3| unnamed protein product [Vitis vinifera] Length = 524 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +2 Query: 2 LYCFNWEVPTGMTKEDIDLEEVINLTVHRKNPLNLVPIKYNC*E 133 LYCF+WE+P GM +D+D+EE+ +T HRK PL LVPIKY C E Sbjct: 481 LYCFDWEMPMGMKTQDMDMEEMGGITTHRKTPLCLVPIKYGCVE 524 >ref|XP_002279272.1| PREDICTED: 2-methylbutanal oxime monooxygenase-like [Vitis vinifera] Length = 522 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +2 Query: 2 LYCFNWEVPTGMTKEDIDLEEVINLTVHRKNPLNLVPIKYNC*E 133 LYCF+WE+P GM +D+D+EE+ +T HRK PL LVPIKY C E Sbjct: 479 LYCFDWEMPMGMKTQDMDMEEMGGITTHRKTPLCLVPIKYGCVE 522 >emb|CAN80448.1| hypothetical protein VITISV_039229 [Vitis vinifera] Length = 524 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +2 Query: 2 LYCFNWEVPTGMTKEDIDLEEVINLTVHRKNPLNLVPIKYNC*E 133 LYCF+WE+P GM +D+D+EE+ +T HRK PL LVPIKY C E Sbjct: 481 LYCFDWEMPMGMKTQDMDMEEMGGITTHRKTPLCLVPIKYGCVE 524 >dbj|BAF98468.1| cytochrome P450 [Coptis japonica var. dissecta] Length = 499 Score = 63.5 bits (153), Expect = 2e-08 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +2 Query: 2 LYCFNWEVPTGMTKEDIDLEEVINLTVHRKNPLNLVPIKYN 124 LYCFNWE+P+GM ED++++E +T+H+K PL+LVPI YN Sbjct: 457 LYCFNWELPSGMKSEDVNIDEKAGITIHKKVPLHLVPIDYN 497 >gb|AFK73716.1| cytochrome P450 [Papaver somniferum] Length = 503 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +2 Query: 2 LYCFNWEVPTGMTKEDIDLEEVINLTVHRKNPLNLVPIKY 121 LYCFNWE+P GM KEDI++EE L+VH+K PL L+ KY Sbjct: 460 LYCFNWELPNGMKKEDINMEESSGLSVHKKYPLELILTKY 499