BLASTX nr result
ID: Cimicifuga21_contig00007754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00007754 (434 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513893.1| WD-repeat protein, putative [Ricinus communi... 60 2e-07 ref|XP_002301041.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 >ref|XP_002513893.1| WD-repeat protein, putative [Ricinus communis] gi|223546979|gb|EEF48476.1| WD-repeat protein, putative [Ricinus communis] Length = 447 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = -3 Query: 432 CKYLNRPGVAFCTKITDGENAITNTVDLYQSAK*ECYHQHGGSLLV 295 CKYLN+PGVAFCTKIT ENAITN VD+ YH H GS+ + Sbjct: 214 CKYLNQPGVAFCTKITTDENAITNAVDI--------YHDHNGSMRI 251 >ref|XP_002301041.1| predicted protein [Populus trichocarpa] gi|222842767|gb|EEE80314.1| predicted protein [Populus trichocarpa] Length = 448 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = -3 Query: 432 CKYLNRPGVAFCTKITDGENAITNTVDLYQSAK*ECYHQHGGSLLV 295 C YLN+PGVAFCTKIT GENAITN VD+ YH H GS+ + Sbjct: 215 CMYLNQPGVAFCTKITTGENAITNAVDV--------YHNHNGSMRI 252