BLASTX nr result
ID: Cimicifuga21_contig00007727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00007727 (672 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP19453.1| bZIP transcription factor family protein 2 [Camel... 56 6e-06 gb|AFP19452.1| bZIP transcription factor family protein 1 [Camel... 56 6e-06 >gb|AFP19453.1| bZIP transcription factor family protein 2 [Camellia sinensis] Length = 270 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/60 (41%), Positives = 39/60 (65%) Frame = -2 Query: 671 RTGEIGALTGQGLGPCDIGNVQRVGNFDSTFMDLPNCGRGNVVATVESAVSSKRKGGNGA 492 ++GE ++ GQG C+ N+Q +GN ++ +LP CG GN +TV S+ ++KRKGG A Sbjct: 209 KSGEDASINGQGFSGCEFENLQCLGNENAGLKELPGCGLGNGASTVNSSGANKRKGGTRA 268 >gb|AFP19452.1| bZIP transcription factor family protein 1 [Camellia sinensis] Length = 270 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/60 (41%), Positives = 39/60 (65%) Frame = -2 Query: 671 RTGEIGALTGQGLGPCDIGNVQRVGNFDSTFMDLPNCGRGNVVATVESAVSSKRKGGNGA 492 ++GE ++ GQG C+ N+Q +GN ++ +LP CG GN +TV S+ ++KRKGG A Sbjct: 209 KSGEDASINGQGFSGCEFENLQCLGNENAGLKELPGCGLGNGASTVNSSGANKRKGGTRA 268