BLASTX nr result
ID: Cimicifuga21_contig00007580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00007580 (764 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004165917.1| PREDICTED: late embryogenesis abundant prote... 66 9e-09 ref|XP_004165915.1| PREDICTED: late embryogenesis abundant prote... 66 9e-09 ref|XP_004136021.1| PREDICTED: indole-3-acetic acid-induced prot... 65 2e-08 gb|AEW24432.1| late embryogenesis abundant protein 3L-1 [Camelli... 64 5e-08 dbj|BAJ34567.1| unnamed protein product [Thellungiella halophila] 64 5e-08 >ref|XP_004165917.1| PREDICTED: late embryogenesis abundant protein Lea5-A-like isoform 3 [Cucumis sativus] Length = 114 Score = 65.9 bits (159), Expect = 9e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -2 Query: 289 SWVPDPVTGYYRPENRTDEVDVAELRETLLNNKRVET 179 SWVPDPVTGYYRPENR+DE+DVAELR LL NK T Sbjct: 71 SWVPDPVTGYYRPENRSDEIDVAELRSILLKNKTKST 107 >ref|XP_004165915.1| PREDICTED: late embryogenesis abundant protein Lea5-A-like isoform 1 [Cucumis sativus] gi|449517767|ref|XP_004165916.1| PREDICTED: late embryogenesis abundant protein Lea5-A-like isoform 2 [Cucumis sativus] Length = 126 Score = 65.9 bits (159), Expect = 9e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -2 Query: 289 SWVPDPVTGYYRPENRTDEVDVAELRETLLNNKRVET 179 SWVPDPVTGYYRPENR+DE+DVAELR LL NK T Sbjct: 83 SWVPDPVTGYYRPENRSDEIDVAELRSILLKNKTKST 119 >ref|XP_004136021.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Cucumis sativus] Length = 104 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 289 SWVPDPVTGYYRPENRTDEVDVAELRETLLNNK 191 SWVPDPVTGYYRPENR+DE+DVAELR LL NK Sbjct: 71 SWVPDPVTGYYRPENRSDEIDVAELRSILLKNK 103 >gb|AEW24432.1| late embryogenesis abundant protein 3L-1 [Camellia sinensis] Length = 96 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 289 SWVPDPVTGYYRPENRTDEVDVAELRETLLNNK 191 SWVPDPVTGYYRPEN+ +E+DVAELRE LL NK Sbjct: 60 SWVPDPVTGYYRPENKANEIDVAELREMLLKNK 92 >dbj|BAJ34567.1| unnamed protein product [Thellungiella halophila] Length = 97 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -2 Query: 295 EESWVPDPVTGYYRPENRTDEVDVAELRETLLNNK 191 E +W PDPVTGYYRP NRTDE+D AELRE LL NK Sbjct: 59 ESAWAPDPVTGYYRPSNRTDEIDPAELREMLLKNK 93