BLASTX nr result
ID: Cimicifuga21_contig00007475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00007475 (400 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF26091.1|AC012393_17 low temperature and salt responsive pr... 84 1e-14 gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6... 84 1e-14 ref|XP_002884539.1| low temperature and salt responsive protein ... 84 1e-14 ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana... 84 1e-14 ref|XP_003626135.1| Hydrophobic protein LTI6B [Medicago truncatu... 83 2e-14 >gb|AAF26091.1|AC012393_17 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] Length = 67 Score = 84.0 bits (206), Expect = 1e-14 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -3 Query: 284 LPPLGVFLRFGCQVEFWICLLLTLFGYLPGILYAIYIITK 165 LPPLGVFL+FGC+VEFWICL+LTLFGYLPGILYA+YIITK Sbjct: 15 LPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6-LTI6b] Length = 726 Score = 84.0 bits (206), Expect = 1e-14 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -3 Query: 284 LPPLGVFLRFGCQVEFWICLLLTLFGYLPGILYAIYIITK 165 LPPLGVFL+FGC+VEFWICL+LTLFGYLPGILYA+YIITK Sbjct: 687 LPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 726 >ref|XP_002884539.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] gi|297330379|gb|EFH60798.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] Length = 67 Score = 84.0 bits (206), Expect = 1e-14 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -3 Query: 284 LPPLGVFLRFGCQVEFWICLLLTLFGYLPGILYAIYIITK 165 LPPLGVFL+FGC+VEFWICL+LTLFGYLPGILYA+YIITK Sbjct: 15 LPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] gi|15214252|sp|Q9ZNS6.1|RCI2B_ARATH RecName: Full=Hydrophobic protein RCI2B; AltName: Full=Low temperature and salt-responsive protein LTI6B gi|6671968|gb|AAF23227.1|AC013454_14 low temperature and salt responsive protein (LTI6B) [Arabidopsis thaliana] gi|13957673|gb|AAK50618.1|AF264749_1 hydrophobic protein RCI2B [Arabidopsis thaliana] gi|4039152|gb|AAC97511.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|4325219|gb|AAD17303.1| hydrophobic protein [Arabidopsis thaliana] gi|21536934|gb|AAM61275.1| hydrophobic protein RCI2B (Low temperature and salt responsive protein LTI6B) [Arabidopsis thaliana] gi|51970648|dbj|BAD44016.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|109134195|gb|ABG25095.1| At3g05890 [Arabidopsis thaliana] gi|110737346|dbj|BAF00618.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|332640791|gb|AEE74312.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] Length = 54 Score = 84.0 bits (206), Expect = 1e-14 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -3 Query: 284 LPPLGVFLRFGCQVEFWICLLLTLFGYLPGILYAIYIITK 165 LPPLGVFL+FGC+VEFWICL+LTLFGYLPGILYA+YIITK Sbjct: 15 LPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >ref|XP_003626135.1| Hydrophobic protein LTI6B [Medicago truncatula] gi|355501150|gb|AES82353.1| Hydrophobic protein LTI6B [Medicago truncatula] Length = 83 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -3 Query: 284 LPPLGVFLRFGCQVEFWICLLLTLFGYLPGILYAIYIITK*TLH 153 LPPLGVFL+FGC VEFW+CL+LTLFGYLPGILYAIY ITK +H Sbjct: 15 LPPLGVFLKFGCHVEFWLCLVLTLFGYLPGILYAIYAITKWIIH 58