BLASTX nr result
ID: Cimicifuga21_contig00007474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00007474 (665 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK4930... 69 1e-09 gb|ADK27676.1| plasma membrane protein 3-1 [Salvia miltiorrhiza] 69 1e-09 gb|AAQ84111.1| Clt1 [Citrus trifoliata] 68 1e-09 gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6... 67 4e-09 gb|ACV50425.1| cold induced plasma membrane protein [Jatropha cu... 65 1e-08 >gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK49304.1| unknown [Lotus japonicus] Length = 54 Score = 68.6 bits (166), Expect = 1e-09 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -2 Query: 493 MAAATCVEIILAIILPPLGVFLRFGIKSEFWICLLLT 383 M ATCV+IILAIILPPLGVFLRFG K EFWICLLLT Sbjct: 1 MGTATCVDIILAIILPPLGVFLRFGCKVEFWICLLLT 37 >gb|ADK27676.1| plasma membrane protein 3-1 [Salvia miltiorrhiza] Length = 55 Score = 68.6 bits (166), Expect = 1e-09 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -2 Query: 493 MAAATCVEIILAIILPPLGVFLRFGIKSEFWICLLLT 383 MAAATC++II+AIILPPLGVFL+FG K EFW+CLLLT Sbjct: 1 MAAATCIDIIVAIILPPLGVFLKFGCKHEFWLCLLLT 37 >gb|AAQ84111.1| Clt1 [Citrus trifoliata] Length = 54 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 493 MAAATCVEIILAIILPPLGVFLRFGIKSEFWICLLLT 383 M ATCV+IILA+ILPPLGVFL+FG K+EFWICLLLT Sbjct: 1 MGTATCVDIILAVILPPLGVFLKFGCKAEFWICLLLT 37 >gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6-LTI6b] Length = 726 Score = 66.6 bits (161), Expect = 4e-09 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -2 Query: 511 CSKTKKMAAATCVEIILAIILPPLGVFLRFGIKSEFWICLLLT 383 C + M+ AT VEIILAIILPPLGVFL+FG K EFWICL+LT Sbjct: 667 CRQAAAMSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILT 709 >gb|ACV50425.1| cold induced plasma membrane protein [Jatropha curcas] Length = 57 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -2 Query: 484 ATCVEIILAIILPPLGVFLRFGIKSEFWICLLLT 383 ATC++I+LA+ILPPLGVFL+FG K+EFWICLLLT Sbjct: 7 ATCIDILLAVILPPLGVFLKFGCKAEFWICLLLT 40