BLASTX nr result
ID: Cimicifuga21_contig00007450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00007450 (866 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB62634.1| putative protein [Arabidopsis thaliana] 77 5e-12 ref|NP_190681.6| zinc finger CCCH domain-containing protein 44 [... 76 9e-12 ref|XP_004164844.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger ... 74 6e-11 ref|XP_004148557.1| PREDICTED: zinc finger CCCH domain-containin... 74 6e-11 ref|XP_002531573.1| set domain protein, putative [Ricinus commun... 73 1e-10 >emb|CAB62634.1| putative protein [Arabidopsis thaliana] Length = 1247 Score = 77.0 bits (188), Expect = 5e-12 Identities = 37/80 (46%), Positives = 47/80 (58%), Gaps = 5/80 (6%) Frame = -3 Query: 681 WLYNDPLGKNQGPFSLDQLRKWSLGGHFPKNLKVWRAEGNLSDSELLIDVIMGRIVK--- 511 W Y DP GK QGPFS+ QLR+W GHFP L++WRA N +S LL D + GR K Sbjct: 674 WHYRDPTGKTQGPFSMVQLRRWKFSGHFPPYLRIWRAHENQDESVLLTDALAGRFDKATT 733 Query: 510 --PYSEVQREIEVSPRDLHR 457 S + +E++ SP D R Sbjct: 734 LPSSSSLPQELKPSPHDSGR 753 >ref|NP_190681.6| zinc finger CCCH domain-containing protein 44 [Arabidopsis thaliana] gi|334302924|sp|Q9SD34.3|C3H44_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 44; Short=AtC3H44 gi|332645232|gb|AEE78753.1| zinc finger CCCH domain-containing protein 44 [Arabidopsis thaliana] Length = 1292 Score = 76.3 bits (186), Expect = 9e-12 Identities = 37/80 (46%), Positives = 47/80 (58%), Gaps = 5/80 (6%) Frame = -3 Query: 681 WLYNDPLGKNQGPFSLDQLRKWSLGGHFPKNLKVWRAEGNLSDSELLIDVIMGRIVK--- 511 W Y DP GK QGPFS+ QLR+W GHFP L++WRA N +S LL D + GR K Sbjct: 719 WHYRDPTGKTQGPFSMVQLRRWKSSGHFPPYLRIWRAHENQDESVLLTDALAGRFDKATT 778 Query: 510 --PYSEVQREIEVSPRDLHR 457 S + +E++ SP D R Sbjct: 779 LPSSSSLPQELKPSPHDSGR 798 >ref|XP_004164844.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing protein 19-like [Cucumis sativus] Length = 1475 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/70 (48%), Positives = 43/70 (61%) Frame = -3 Query: 681 WLYNDPLGKNQGPFSLDQLRKWSLGGHFPKNLKVWRAEGNLSDSELLIDVIMGRIVKPYS 502 W Y DP GK QGPFS+ QLRKWS G+FP +L++WR DS LL DV+ G+I K Sbjct: 895 WHYQDPSGKVQGPFSMVQLRKWSNTGYFPTDLRIWRISDQQEDSLLLTDVLAGKISKDTP 954 Query: 501 EVQREIEVSP 472 ++V P Sbjct: 955 LTSNSLQVHP 964 >ref|XP_004148557.1| PREDICTED: zinc finger CCCH domain-containing protein 19-like [Cucumis sativus] Length = 1470 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/70 (48%), Positives = 43/70 (61%) Frame = -3 Query: 681 WLYNDPLGKNQGPFSLDQLRKWSLGGHFPKNLKVWRAEGNLSDSELLIDVIMGRIVKPYS 502 W Y DP GK QGPFS+ QLRKWS G+FP +L++WR DS LL DV+ G+I K Sbjct: 895 WHYQDPSGKVQGPFSMVQLRKWSNTGYFPTDLRIWRISDQQEDSLLLTDVLAGKISKDTP 954 Query: 501 EVQREIEVSP 472 ++V P Sbjct: 955 LTSNSLQVHP 964 >ref|XP_002531573.1| set domain protein, putative [Ricinus communis] gi|223528803|gb|EEF30809.1| set domain protein, putative [Ricinus communis] Length = 1058 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/57 (57%), Positives = 38/57 (66%) Frame = -3 Query: 681 WLYNDPLGKNQGPFSLDQLRKWSLGGHFPKNLKVWRAEGNLSDSELLIDVIMGRIVK 511 WLY DP GK QGPFS+ QLRKWS GHFP + +VWR DS LL D + GR+ K Sbjct: 1000 WLYQDPSGKIQGPFSIVQLRKWSSKGHFPPHFRVWRTGEKQDDSILLTDALDGRVPK 1056