BLASTX nr result
ID: Cimicifuga21_contig00007292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00007292 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB63310.1| 18.6 kDa heat-shock protein [Helianthus annuus] 76 2e-12 ref|XP_004162776.1| PREDICTED: 18.2 kDa class I heat shock prote... 75 6e-12 ref|XP_004150235.1| PREDICTED: 17.6 kDa class I heat shock prote... 75 6e-12 gb|ADM47405.1| small molecular heat shock protein [Nicotiana tab... 75 7e-12 gb|ADU55789.1| HSP18.1A [Citrullus lanatus] 74 1e-11 >gb|AAB63310.1| 18.6 kDa heat-shock protein [Helianthus annuus] Length = 163 Score = 76.3 bits (186), Expect = 2e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +3 Query: 198 MSIIPSFFGGRRSNVFDPFSLDIWDPFEGFPFSNNNNFRSLAE 326 MSIIP+FFG RR+N FDPFSLD+WDPFEGFPF NNNNF SL++ Sbjct: 1 MSIIPNFFGRRRTNCFDPFSLDVWDPFEGFPF-NNNNFGSLSD 42 >ref|XP_004162776.1| PREDICTED: 18.2 kDa class I heat shock protein-like [Cucumis sativus] Length = 159 Score = 75.1 bits (183), Expect = 6e-12 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = +3 Query: 198 MSIIPSFFGGRRSNVFDPFSLDIWDPFEGFPFSNNNNFRSLAENRPNFSNET 353 M+++PS FGGRRSNVFDPFSLDIWDPFEGFPFSN SLA N P+ + ET Sbjct: 1 MALVPSIFGGRRSNVFDPFSLDIWDPFEGFPFSN-----SLA-NAPSSARET 46 >ref|XP_004150235.1| PREDICTED: 17.6 kDa class I heat shock protein 3-like [Cucumis sativus] Length = 159 Score = 75.1 bits (183), Expect = 6e-12 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = +3 Query: 198 MSIIPSFFGGRRSNVFDPFSLDIWDPFEGFPFSNNNNFRSLAENRPNFSNET 353 M+++PS FGGRRSNVFDPFSLDIWDPFEGFPFSN SLA N P+ + ET Sbjct: 1 MALVPSIFGGRRSNVFDPFSLDIWDPFEGFPFSN-----SLA-NAPSSARET 46 >gb|ADM47405.1| small molecular heat shock protein [Nicotiana tabacum] Length = 159 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = +3 Query: 198 MSIIPSFFGGRRSNVFDPFSLDIWDPFEGFPFSNNNNFRSLAENRPNFSNET 353 MS+IPSFFGGRRSN+FDPFSLD+WDPFEGFPFS R++A N P + ET Sbjct: 1 MSLIPSFFGGRRSNIFDPFSLDLWDPFEGFPFS-----RTVA-NTPTSARET 46 >gb|ADU55789.1| HSP18.1A [Citrullus lanatus] Length = 159 Score = 73.9 bits (180), Expect = 1e-11 Identities = 34/51 (66%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = +3 Query: 198 MSIIPSFFGGRRSNVFDPFSLDIWDPFEGFPFSNN-NNFRSLAENRPNFSN 347 M++IP+ FGGRRSNVFDPFSLD+WDPFEGFPFSN+ N S A F+N Sbjct: 1 MALIPTIFGGRRSNVFDPFSLDVWDPFEGFPFSNSLANLPSSARETSAFAN 51