BLASTX nr result
ID: Cimicifuga21_contig00007270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00007270 (439 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330154.1| predicted protein [Populus trichocarpa] gi|2... 80 3e-29 ref|XP_002512422.1| respiratory burst oxidase, putative [Ricinus... 80 1e-28 sp|Q948T9.1|RBOHB_SOLTU RecName: Full=Respiratory burst oxidase ... 80 4e-28 ref|XP_003554649.1| PREDICTED: respiratory burst oxidase homolog... 79 1e-27 ref|XP_003554650.1| PREDICTED: respiratory burst oxidase homolog... 79 1e-27 >ref|XP_002330154.1| predicted protein [Populus trichocarpa] gi|222871610|gb|EEF08741.1| predicted protein [Populus trichocarpa] Length = 876 Score = 80.1 bits (196), Expect(2) = 3e-29 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = +3 Query: 36 LVQVAVYPGNVLALHMSKPQGFKYRSGQYIFVNCSTISSFQW 161 +++VAVYPGNVLALHMSKPQGF+Y SGQY+FVNCS +S+FQW Sbjct: 569 ILKVAVYPGNVLALHMSKPQGFRYTSGQYVFVNCSAVSTFQW 610 Score = 73.2 bits (178), Expect(2) = 3e-29 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 241 HPFSITSAPGDDYLSVHIRTLGDWTSQLRALFSKV 345 HPFSITSAPGDDYLS+HIRTLGDWTSQL+A+FSKV Sbjct: 611 HPFSITSAPGDDYLSIHIRTLGDWTSQLKAVFSKV 645 >ref|XP_002512422.1| respiratory burst oxidase, putative [Ricinus communis] gi|223548383|gb|EEF49874.1| respiratory burst oxidase, putative [Ricinus communis] Length = 888 Score = 79.7 bits (195), Expect(2) = 1e-28 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +3 Query: 36 LVQVAVYPGNVLALHMSKPQGFKYRSGQYIFVNCSTISSFQW 161 +++VAVYPGNVLALHMSKPQGF+Y SGQYIFVNCS +S FQW Sbjct: 580 ILKVAVYPGNVLALHMSKPQGFRYTSGQYIFVNCSAVSPFQW 621 Score = 72.0 bits (175), Expect(2) = 1e-28 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 241 HPFSITSAPGDDYLSVHIRTLGDWTSQLRALFSKV 345 HPFSITSAPGDDYLS+HIRTLGDWTSQL+++FSKV Sbjct: 622 HPFSITSAPGDDYLSIHIRTLGDWTSQLKSVFSKV 656 >sp|Q948T9.1|RBOHB_SOLTU RecName: Full=Respiratory burst oxidase homolog protein B; AltName: Full=NADPH oxidase RBOHB; AltName: Full=StRBOHB gi|16549089|dbj|BAB70751.1| respiratory burst oxidase homolog [Solanum tuberosum] Length = 867 Score = 80.5 bits (197), Expect(2) = 4e-28 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = +3 Query: 36 LVQVAVYPGNVLALHMSKPQGFKYRSGQYIFVNCSTISSFQW 161 +++VAVYPGNV+A+HMSKPQGFKY SGQYIFVNCS +SSFQW Sbjct: 565 ILKVAVYPGNVMAVHMSKPQGFKYTSGQYIFVNCSDVSSFQW 606 Score = 69.3 bits (168), Expect(2) = 4e-28 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +1 Query: 241 HPFSITSAPGDDYLSVHIRTLGDWTSQLRALFSKV 345 HPF+I+SAPGDDYLS+HIRTLGDWTSQL+ LFSKV Sbjct: 607 HPFTISSAPGDDYLSMHIRTLGDWTSQLKTLFSKV 641 >ref|XP_003554649.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 1 [Glycine max] Length = 887 Score = 78.6 bits (192), Expect(2) = 1e-27 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +3 Query: 36 LVQVAVYPGNVLALHMSKPQGFKYRSGQYIFVNCSTISSFQW 161 +++VAVYPGNVLALHMSKPQGFKY SGQYIFVNC +S FQW Sbjct: 580 ILKVAVYPGNVLALHMSKPQGFKYSSGQYIFVNCPDVSPFQW 621 Score = 69.7 bits (169), Expect(2) = 1e-27 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +1 Query: 241 HPFSITSAPGDDYLSVHIRTLGDWTSQLRALFSK 342 HPFSITSAPGDDY+SVHIRTLGDWTSQL+A+F+K Sbjct: 622 HPFSITSAPGDDYVSVHIRTLGDWTSQLKAVFAK 655 >ref|XP_003554650.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 2 [Glycine max] Length = 886 Score = 78.6 bits (192), Expect(2) = 1e-27 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +3 Query: 36 LVQVAVYPGNVLALHMSKPQGFKYRSGQYIFVNCSTISSFQW 161 +++VAVYPGNVLALHMSKPQGFKY SGQYIFVNC +S FQW Sbjct: 580 ILKVAVYPGNVLALHMSKPQGFKYSSGQYIFVNCPDVSPFQW 621 Score = 69.7 bits (169), Expect(2) = 1e-27 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +1 Query: 241 HPFSITSAPGDDYLSVHIRTLGDWTSQLRALFSK 342 HPFSITSAPGDDY+SVHIRTLGDWTSQL+A+F+K Sbjct: 622 HPFSITSAPGDDYVSVHIRTLGDWTSQLKAVFAK 655