BLASTX nr result
ID: Cimicifuga21_contig00007266
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00007266 (385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003592404.1| Primary amine oxidase [Medicago truncatula] ... 69 4e-10 ref|XP_002278182.1| PREDICTED: primary amine oxidase [Vitis vini... 67 2e-09 emb|CAN76699.1| hypothetical protein VITISV_012123 [Vitis vinifera] 67 2e-09 ref|XP_003556043.1| PREDICTED: primary amine oxidase-like [Glyci... 66 3e-09 ref|XP_002315777.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 >ref|XP_003592404.1| Primary amine oxidase [Medicago truncatula] gi|355481452|gb|AES62655.1| Primary amine oxidase [Medicago truncatula] Length = 675 Score = 68.9 bits (167), Expect = 4e-10 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 1 MPTLSGGFELRPANFFNSNPVLKTRIPKPVYWPNC 105 MPTLSGGFELRP NFF SNPVLKT+ PK V+WPNC Sbjct: 637 MPTLSGGFELRPTNFFESNPVLKTKSPKAVHWPNC 671 >ref|XP_002278182.1| PREDICTED: primary amine oxidase [Vitis vinifera] gi|297737032|emb|CBI26233.3| unnamed protein product [Vitis vinifera] Length = 667 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 1 MPTLSGGFELRPANFFNSNPVLKTRIPKPVYWPNC 105 MPTLSGGFELRP NFF +NPVLKT+ P PV WPNC Sbjct: 631 MPTLSGGFELRPTNFFENNPVLKTKPPTPVSWPNC 665 >emb|CAN76699.1| hypothetical protein VITISV_012123 [Vitis vinifera] Length = 654 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 1 MPTLSGGFELRPANFFNSNPVLKTRIPKPVYWPNC 105 MPTLSGGFELRP NFF +NPVLKT+ P PV WPNC Sbjct: 618 MPTLSGGFELRPTNFFENNPVLKTKPPTPVSWPNC 652 >ref|XP_003556043.1| PREDICTED: primary amine oxidase-like [Glycine max] Length = 675 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 1 MPTLSGGFELRPANFFNSNPVLKTRIPKPVYWPNC 105 MPTLSGGFELRP NFF NPVLKT+ PKPV++PNC Sbjct: 637 MPTLSGGFELRPTNFFERNPVLKTKSPKPVHFPNC 671 >ref|XP_002315777.1| predicted protein [Populus trichocarpa] gi|222864817|gb|EEF01948.1| predicted protein [Populus trichocarpa] Length = 413 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = +1 Query: 1 MPTLSGGFELRPANFFNSNPVLKTRIPKPVYWPNC 105 MPTLS GFELRPANFF SNPVLK PKPV WPNC Sbjct: 376 MPTLSAGFELRPANFFESNPVLKVLPPKPVRWPNC 410