BLASTX nr result
ID: Cimicifuga21_contig00007190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00007190 (950 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527695.1| glutaredoxin-1, grx1, putative [Ricinus comm... 169 7e-40 ref|XP_002325236.1| glutaredoxin C4 [Populus trichocarpa] gi|118... 169 1e-39 gb|AAL90750.1| glutaredoxin [Populus tremula x Populus tremuloides] 169 1e-39 ref|NP_197550.1| glutaredoxin-C4 [Arabidopsis thaliana] gi|11937... 164 3e-38 gb|ADA70346.1| glutaredoxin [Litchi chinensis] 164 4e-38 >ref|XP_002527695.1| glutaredoxin-1, grx1, putative [Ricinus communis] gi|223532926|gb|EEF34694.1| glutaredoxin-1, grx1, putative [Ricinus communis] Length = 140 Score = 169 bits (429), Expect = 7e-40 Identities = 79/103 (76%), Positives = 96/103 (93%), Gaps = 1/103 (0%) Frame = +2 Query: 299 ESAFVKETISSHNIVIFSKSYCPYCMKAKAIFKEMKQLPHIIELDERDDGQSLQDALSEM 478 +SAFVK+TISSH IVIFSKSYCPYC +AKA+FK++ Q+PH++ELDERDDGQ++QDALS++ Sbjct: 38 DSAFVKKTISSHKIVIFSKSYCPYCKRAKAVFKQLNQIPHVVELDERDDGQNIQDALSKI 97 Query: 479 VGRRTVPQVFVNGKHIGGSDDTVEAYESGTLAKLLGVS-KDGL 604 VGRRTVPQVF++GKHIGGSDDTVEAYESG LA LLG++ KD L Sbjct: 98 VGRRTVPQVFIDGKHIGGSDDTVEAYESGELADLLGIAGKDDL 140 >ref|XP_002325236.1| glutaredoxin C4 [Populus trichocarpa] gi|118483557|gb|ABK93676.1| unknown [Populus trichocarpa] gi|118488597|gb|ABK96111.1| unknown [Populus trichocarpa] gi|222866670|gb|EEF03801.1| glutaredoxin C4 [Populus trichocarpa] Length = 136 Score = 169 bits (427), Expect = 1e-39 Identities = 76/101 (75%), Positives = 91/101 (90%) Frame = +2 Query: 296 PESAFVKETISSHNIVIFSKSYCPYCMKAKAIFKEMKQLPHIIELDERDDGQSLQDALSE 475 PE+ FVK+TISSH IVIFSKSYCPYC KAK +FKE+ Q PH++ELD+R+DG +QDA+SE Sbjct: 31 PEATFVKKTISSHQIVIFSKSYCPYCKKAKGVFKELNQTPHVVELDQREDGHDIQDAMSE 90 Query: 476 MVGRRTVPQVFVNGKHIGGSDDTVEAYESGTLAKLLGVSKD 598 +VGRRTVPQVF++GKHIGGSDDTVEAYESG LAKLLGV+ + Sbjct: 91 IVGRRTVPQVFIDGKHIGGSDDTVEAYESGELAKLLGVASE 131 >gb|AAL90750.1| glutaredoxin [Populus tremula x Populus tremuloides] Length = 139 Score = 169 bits (427), Expect = 1e-39 Identities = 76/101 (75%), Positives = 91/101 (90%) Frame = +2 Query: 296 PESAFVKETISSHNIVIFSKSYCPYCMKAKAIFKEMKQLPHIIELDERDDGQSLQDALSE 475 PE+ FVK+TISSH IVIFSKSYCPYC KAK +FKE+ Q PH++ELD+R+DG +QDA+SE Sbjct: 31 PEATFVKKTISSHQIVIFSKSYCPYCKKAKGVFKELNQTPHVVELDQREDGHDIQDAMSE 90 Query: 476 MVGRRTVPQVFVNGKHIGGSDDTVEAYESGTLAKLLGVSKD 598 +VGRRTVPQVF++GKHIGGSDDTVEAYESG LAKLLGV+ + Sbjct: 91 IVGRRTVPQVFIDGKHIGGSDDTVEAYESGELAKLLGVASE 131 >ref|NP_197550.1| glutaredoxin-C4 [Arabidopsis thaliana] gi|119370637|sp|Q8LFQ6.2|GRXC4_ARATH RecName: Full=Glutaredoxin-C4; Short=AtGrxC4 gi|6735386|emb|CAB69043.1| glutaredoxin [Arabidopsis thaliana] gi|25082927|gb|AAN72016.1| glutaredoxin [Arabidopsis thaliana] gi|25082941|gb|AAN72019.1| glutaredoxin [Arabidopsis thaliana] gi|98960865|gb|ABF58916.1| At5g20500 [Arabidopsis thaliana] gi|332005470|gb|AED92853.1| glutaredoxin-C4 [Arabidopsis thaliana] Length = 135 Score = 164 bits (415), Expect = 3e-38 Identities = 75/99 (75%), Positives = 91/99 (91%) Frame = +2 Query: 296 PESAFVKETISSHNIVIFSKSYCPYCMKAKAIFKEMKQLPHIIELDERDDGQSLQDALSE 475 PE+ FVK+TISSH IVIFSKSYCPYC KAK++F+E+ Q+P+++ELDER+DG S+Q AL E Sbjct: 30 PEADFVKKTISSHKIVIFSKSYCPYCKKAKSVFRELDQVPYVVELDEREDGWSIQTALGE 89 Query: 476 MVGRRTVPQVFVNGKHIGGSDDTVEAYESGTLAKLLGVS 592 +VGRRTVPQVF+NGKH+GGSDDTV+AYESG LAKLLGVS Sbjct: 90 IVGRRTVPQVFINGKHLGGSDDTVDAYESGELAKLLGVS 128 >gb|ADA70346.1| glutaredoxin [Litchi chinensis] Length = 132 Score = 164 bits (414), Expect = 4e-38 Identities = 74/100 (74%), Positives = 92/100 (92%) Frame = +2 Query: 293 DPESAFVKETISSHNIVIFSKSYCPYCMKAKAIFKEMKQLPHIIELDERDDGQSLQDALS 472 +PE FVK+TISSH IVIFSKSYCPYC +AK++FKE+ Q+PH+IEL+ERDDG ++QDA+S Sbjct: 26 NPEVDFVKKTISSHQIVIFSKSYCPYCKRAKSVFKELNQVPHVIELNERDDGSAIQDAVS 85 Query: 473 EMVGRRTVPQVFVNGKHIGGSDDTVEAYESGTLAKLLGVS 592 E+VGRRTVPQVF++GKHIGGSDDTVEAYE+G L KLLG++ Sbjct: 86 EIVGRRTVPQVFIDGKHIGGSDDTVEAYENGKLHKLLGIA 125