BLASTX nr result
ID: Cimicifuga21_contig00007173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00007173 (643 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326464.1| predicted protein [Populus trichocarpa] gi|2... 69 1e-09 gb|ACP39958.1| pentatricopeptide repeat protein [Gossypium hirsu... 65 8e-09 ref|XP_003530408.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_004139002.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_003631455.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 >ref|XP_002326464.1| predicted protein [Populus trichocarpa] gi|222833786|gb|EEE72263.1| predicted protein [Populus trichocarpa] Length = 476 Score = 68.6 bits (166), Expect = 1e-09 Identities = 34/66 (51%), Positives = 46/66 (69%) Frame = +2 Query: 2 LPSVDSDIYSILLVGLCQRGHLVEAATLINVMGKRKIKLKAPNAYTIIESLQNSGERELA 181 L S+D DIYSILL GLCQ+GH EAA L M +++I L+AP+ I+E L+N G +EL Sbjct: 409 LSSIDIDIYSILLAGLCQQGHSAEAARLARSMLEKRIPLRAPHVEKIVEHLKNFGGKELV 468 Query: 182 MHLMNM 199 L++M Sbjct: 469 AELVSM 474 >gb|ACP39958.1| pentatricopeptide repeat protein [Gossypium hirsutum] gi|227463014|gb|ACP39959.1| pentatricopeptide repeat protein [Gossypium hirsutum] Length = 288 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/63 (50%), Positives = 46/63 (73%) Frame = +2 Query: 2 LPSVDSDIYSILLVGLCQRGHLVEAATLINVMGKRKIKLKAPNAYTIIESLQNSGERELA 181 + S+D+DIYSILLVGLC++ H VEA L +M +R+I+L+AP II+ L+NS ++EL Sbjct: 221 ISSIDTDIYSILLVGLCRQSHSVEAVKLARLMLRRRIRLEAPYVDEIIKHLKNSTDKELV 280 Query: 182 MHL 190 L Sbjct: 281 TQL 283 >ref|XP_003530408.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Glycine max] Length = 475 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/63 (50%), Positives = 42/63 (66%) Frame = +2 Query: 2 LPSVDSDIYSILLVGLCQRGHLVEAATLINVMGKRKIKLKAPNAYTIIESLQNSGERELA 181 L S+DSDIYSILL+GLCQR HL EA L +M K+ + L+ P+ I+ L SGE++L Sbjct: 405 LSSIDSDIYSILLIGLCQRSHLKEATKLAKIMLKKSVLLQPPHKDAAIDILIKSGEKDLV 464 Query: 182 MHL 190 L Sbjct: 465 NQL 467 >ref|XP_004139002.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Cucumis sativus] gi|449505643|ref|XP_004162530.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Cucumis sativus] Length = 475 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/63 (52%), Positives = 45/63 (71%) Frame = +2 Query: 2 LPSVDSDIYSILLVGLCQRGHLVEAATLINVMGKRKIKLKAPNAYTIIESLQNSGERELA 181 L S+D+DIYS+LLVGLC+ H V+AA L +M K+ I+LK A +II+ L+ +REL Sbjct: 408 LCSIDADIYSLLLVGLCEHDHSVDAAKLARLMLKKGIRLKPHYAESIIKHLKKFEDRELV 467 Query: 182 MHL 190 MHL Sbjct: 468 MHL 470 >ref|XP_003631455.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Vitis vinifera] Length = 638 Score = 63.2 bits (152), Expect = 4e-08 Identities = 33/63 (52%), Positives = 44/63 (69%) Frame = +2 Query: 2 LPSVDSDIYSILLVGLCQRGHLVEAATLINVMGKRKIKLKAPNAYTIIESLQNSGERELA 181 L +DSDIYSILLVGL Q+ H VEA L +M R I+LK P +I+E L+ SG++E+ Sbjct: 404 LSYLDSDIYSILLVGLSQKRHSVEAVKLARLMVDRGIQLKTPYFDSIVEHLKESGDKEIV 463 Query: 182 MHL 190 M+L Sbjct: 464 MYL 466