BLASTX nr result
ID: Cimicifuga21_contig00007170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00007170 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73792.1| hypothetical protein VITISV_034893 [Vitis vinifera] 51 4e-06 >emb|CAN73792.1| hypothetical protein VITISV_034893 [Vitis vinifera] Length = 720 Score = 50.8 bits (120), Expect(2) = 4e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -3 Query: 203 QEKVHGKMHGCGDDAHVTMLPVAAKLLIHRKYHLKV 96 + K+ GKMHGCG DAH TML AAKLL RK+ LK+ Sbjct: 646 KSKIDGKMHGCGHDAHTTMLLGAAKLLSQRKHKLKI 681 Score = 24.6 bits (52), Expect(2) = 4e-06 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 247 SAKVERV*ELVEWEHKRK 194 ++ V + ELVEWEHK K Sbjct: 631 ASSVSLLRELVEWEHKSK 648