BLASTX nr result
ID: Cimicifuga21_contig00006879
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00006879 (541 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW69791.1| Hop-interacting protein THI028 [Solanum lycopersi... 55 5e-06 >gb|AEW69791.1| Hop-interacting protein THI028 [Solanum lycopersicum] Length = 563 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/61 (45%), Positives = 35/61 (57%) Frame = -3 Query: 521 AQPMPQPNPYSQVEPSYSQHPQPPSTAPANPFGDTSFVPFTADIAPQPQSNTNPFGTNGI 342 A P Q NP+ EP+Y Q PQ P P NPFGD F F + PQ+ TNPFG+ G+ Sbjct: 505 AVPQHQMNPFGPFEPAYPQ-PQNPMLNPHNPFGDAGFSAFPTNHVAHPQT-TNPFGSTGL 562 Query: 341 L 339 + Sbjct: 563 I 563