BLASTX nr result
ID: Cimicifuga21_contig00006752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00006752 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633213.1| PREDICTED: probable xyloglucan endotransgluc... 96 2e-18 ref|XP_003625289.1| Xyloglucan endotransglucosylase/hydrolase [M... 96 3e-18 ref|XP_003542156.1| PREDICTED: probable xyloglucan endotransgluc... 94 9e-18 emb|CBI17811.3| unnamed protein product [Vitis vinifera] 94 9e-18 gb|ACU22849.1| unknown [Glycine max] 94 9e-18 >ref|XP_003633213.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 23-like [Vitis vinifera] Length = 345 Score = 96.3 bits (238), Expect = 2e-18 Identities = 43/48 (89%), Positives = 48/48 (100%) Frame = +2 Query: 116 AGNFYQEFDLTWGDGRSKILNNGQLLTLSLDKTSGSGFQSKHEYLFGK 259 AGNFYQ+FD+TWGDGR+KILNNG+LLTLSLDKTSGSGFQSK+EYLFGK Sbjct: 29 AGNFYQDFDITWGDGRAKILNNGELLTLSLDKTSGSGFQSKNEYLFGK 76 >ref|XP_003625289.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula] gi|355500304|gb|AES81507.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula] gi|388522479|gb|AFK49301.1| unknown [Medicago truncatula] Length = 282 Score = 95.9 bits (237), Expect = 3e-18 Identities = 43/48 (89%), Positives = 48/48 (100%) Frame = +2 Query: 116 AGNFYQEFDLTWGDGRSKILNNGQLLTLSLDKTSGSGFQSKHEYLFGK 259 AGNFYQ+FD+TWGDGR+KILNNGQLLTLSLDK+SGSGFQSK+EYLFGK Sbjct: 21 AGNFYQDFDITWGDGRAKILNNGQLLTLSLDKSSGSGFQSKNEYLFGK 68 >ref|XP_003542156.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 23-like [Glycine max] Length = 285 Score = 94.4 bits (233), Expect = 9e-18 Identities = 42/48 (87%), Positives = 47/48 (97%) Frame = +2 Query: 116 AGNFYQEFDLTWGDGRSKILNNGQLLTLSLDKTSGSGFQSKHEYLFGK 259 AGNFYQ+FD+TWGDGR+KILNNG+LLTLSLDK SGSGFQSK+EYLFGK Sbjct: 22 AGNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGK 69 >emb|CBI17811.3| unnamed protein product [Vitis vinifera] Length = 1552 Score = 94.4 bits (233), Expect = 9e-18 Identities = 42/48 (87%), Positives = 47/48 (97%) Frame = +2 Query: 116 AGNFYQEFDLTWGDGRSKILNNGQLLTLSLDKTSGSGFQSKHEYLFGK 259 AGNFYQ+FD+TWGDGR+KILNNG+LLTLSLDK SGSGFQSK+EYLFGK Sbjct: 1324 AGNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGK 1371 >gb|ACU22849.1| unknown [Glycine max] Length = 200 Score = 94.4 bits (233), Expect = 9e-18 Identities = 42/48 (87%), Positives = 47/48 (97%) Frame = +2 Query: 116 AGNFYQEFDLTWGDGRSKILNNGQLLTLSLDKTSGSGFQSKHEYLFGK 259 AGNFYQ+FD+TWGDGR+KILNNG+LLTLSLDK SGSGFQSK+EYLFGK Sbjct: 22 AGNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGK 69