BLASTX nr result
ID: Cimicifuga21_contig00006607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00006607 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265701.2| PREDICTED: uncharacterized protein LOC100265... 88 6e-16 emb|CBI37504.3| unnamed protein product [Vitis vinifera] 88 6e-16 gb|AFW73101.1| hypothetical protein ZEAMMB73_531442 [Zea mays] 82 5e-14 ref|XP_003547885.1| PREDICTED: trafficking protein particle comp... 81 8e-14 ref|XP_002454394.1| hypothetical protein SORBIDRAFT_04g029980 [S... 80 2e-13 >ref|XP_002265701.2| PREDICTED: uncharacterized protein LOC100265343 [Vitis vinifera] Length = 1185 Score = 88.2 bits (217), Expect = 6e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +1 Query: 121 MEDYAEELRTPPVTLVSLVGCPELHSTISTFLHTEQPPINTLALPDF 261 ME+Y EELRTPPV+L+SLVGCPELHS IST LH+EQPPINTLALPDF Sbjct: 1 MEEYPEELRTPPVSLISLVGCPELHSLISTHLHSEQPPINTLALPDF 47 >emb|CBI37504.3| unnamed protein product [Vitis vinifera] Length = 1042 Score = 88.2 bits (217), Expect = 6e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +1 Query: 121 MEDYAEELRTPPVTLVSLVGCPELHSTISTFLHTEQPPINTLALPDF 261 ME+Y EELRTPPV+L+SLVGCPELHS IST LH+EQPPINTLALPDF Sbjct: 1 MEEYPEELRTPPVSLISLVGCPELHSLISTHLHSEQPPINTLALPDF 47 >gb|AFW73101.1| hypothetical protein ZEAMMB73_531442 [Zea mays] Length = 1170 Score = 82.0 bits (201), Expect = 5e-14 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = +1 Query: 121 MEDYAEELRTPPVTLVSLVGCPELHSTISTFLHTEQPPINTLALPDF 261 MEDY EELRTPPV+LVS+VGCPELH +IST L ++QPP+NTLALPDF Sbjct: 1 MEDYPEELRTPPVSLVSIVGCPELHPSISTALSSQQPPMNTLALPDF 47 >ref|XP_003547885.1| PREDICTED: trafficking protein particle complex subunit 11-like [Glycine max] Length = 1187 Score = 81.3 bits (199), Expect = 8e-14 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = +1 Query: 121 MEDYAEELRTPPVTLVSLVGCPELHSTISTFLHTEQPPINTLALPDF 261 ME+Y EELRTPPVTL SLVGCPELH+ IST L + QPPINTLALPDF Sbjct: 1 MEEYPEELRTPPVTLASLVGCPELHTLISTHLMSAQPPINTLALPDF 47 >ref|XP_002454394.1| hypothetical protein SORBIDRAFT_04g029980 [Sorghum bicolor] gi|241934225|gb|EES07370.1| hypothetical protein SORBIDRAFT_04g029980 [Sorghum bicolor] Length = 1178 Score = 80.1 bits (196), Expect = 2e-13 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = +1 Query: 121 MEDYAEELRTPPVTLVSLVGCPELHSTISTFLHTEQPPINTLALPDF 261 MEDY EELRTPPV+LVS+VGCPELH +IS L ++QPP+NTLALPDF Sbjct: 1 MEDYPEELRTPPVSLVSIVGCPELHPSISAALSSQQPPMNTLALPDF 47