BLASTX nr result
ID: Cimicifuga21_contig00005608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00005608 (448 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003613511.1| NBS resistance protein [Medicago truncatula]... 86 3e-15 ref|XP_003613325.1| Resistance protein [Medicago truncatula] gi|... 83 3e-14 ref|XP_003613271.1| NBS-LRR resistance protein [Medicago truncat... 82 5e-14 ref|XP_002532127.1| leucine-rich repeat containing protein, puta... 82 6e-14 ref|XP_003517872.1| PREDICTED: disease resistance protein RGA2-l... 80 2e-13 >ref|XP_003613511.1| NBS resistance protein [Medicago truncatula] gi|355514846|gb|AES96469.1| NBS resistance protein [Medicago truncatula] Length = 1071 Score = 85.9 bits (211), Expect = 3e-15 Identities = 35/59 (59%), Positives = 50/59 (84%) Frame = -3 Query: 446 VDLDPMQNQLKKLLHGNKFLLVLDDVWDDGREKWEKIKYLLTCGSKGSSIIVTTRLPEV 270 +DL+P+Q +L LL G ++LLVLDDVWDD +E W+++KY+L CG KG+S++VTTRLP+V Sbjct: 254 LDLEPLQRKLLDLLKGKRYLLVLDDVWDDEQENWQRLKYVLACGGKGASVLVTTRLPKV 312 >ref|XP_003613325.1| Resistance protein [Medicago truncatula] gi|355514660|gb|AES96283.1| Resistance protein [Medicago truncatula] Length = 499 Score = 82.8 bits (203), Expect = 3e-14 Identities = 34/59 (57%), Positives = 49/59 (83%) Frame = -3 Query: 446 VDLDPMQNQLKKLLHGNKFLLVLDDVWDDGREKWEKIKYLLTCGSKGSSIIVTTRLPEV 270 +DL+P+Q +L LL ++LLVLDDVWDDG+E W+++K +L CG KG+S++VTTRLP+V Sbjct: 254 LDLEPLQRKLLDLLRRKRYLLVLDDVWDDGQENWQRLKSVLACGGKGASVLVTTRLPKV 312 >ref|XP_003613271.1| NBS-LRR resistance protein [Medicago truncatula] gi|355514606|gb|AES96229.1| NBS-LRR resistance protein [Medicago truncatula] Length = 932 Score = 82.0 bits (201), Expect = 5e-14 Identities = 34/61 (55%), Positives = 50/61 (81%) Frame = -3 Query: 446 VDLDPMQNQLKKLLHGNKFLLVLDDVWDDGREKWEKIKYLLTCGSKGSSIIVTTRLPEVV 267 +DL+P+Q +L+ LL G +FLLVLDDVWDD +E W++++ +L CG KG+SI+VTTRL +V Sbjct: 239 LDLEPLQRRLQHLLQGKRFLLVLDDVWDDKQENWQRLRSVLACGGKGASILVTTRLAKVA 298 Query: 266 D 264 + Sbjct: 299 E 299 >ref|XP_002532127.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223528186|gb|EEF30247.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 1142 Score = 81.6 bits (200), Expect = 6e-14 Identities = 33/59 (55%), Positives = 51/59 (86%) Frame = -3 Query: 446 VDLDPMQNQLKKLLHGNKFLLVLDDVWDDGREKWEKIKYLLTCGSKGSSIIVTTRLPEV 270 +DLDP+Q QL+++L G ++L+VLD VW+ ++KW+++K++L CGSKGSSIIVTTR+ +V Sbjct: 229 LDLDPLQRQLQEILSGKRYLIVLDHVWNGDQDKWDRLKFVLACGSKGSSIIVTTRMEKV 287 >ref|XP_003517872.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] Length = 899 Score = 79.7 bits (195), Expect = 2e-13 Identities = 33/59 (55%), Positives = 50/59 (84%) Frame = -3 Query: 446 VDLDPMQNQLKKLLHGNKFLLVLDDVWDDGREKWEKIKYLLTCGSKGSSIIVTTRLPEV 270 +DL+P+Q +L+ LL ++LLVLDDVWD+ +E W+++K +L CG+KG+SI+VTTRLP+V Sbjct: 228 LDLEPLQRRLQDLLQRKRYLLVLDDVWDEVQENWQRLKSVLACGAKGASILVTTRLPKV 286