BLASTX nr result
ID: Cimicifuga21_contig00005288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00005288 (881 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511150.1| metal ion binding protein, putative [Ricinus... 57 7e-06 >ref|XP_002511150.1| metal ion binding protein, putative [Ricinus communis] gi|223550265|gb|EEF51752.1| metal ion binding protein, putative [Ricinus communis] Length = 349 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/38 (65%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -1 Query: 200 VDREKNEVYQYPPKYRLE-YAYPPQIFSDDNPNAWCSI 90 ++ +KNE Y YPP+Y +E YAYPPQIFSD+NPNA CS+ Sbjct: 312 IELKKNEYYYYPPRYAMELYAYPPQIFSDENPNA-CSV 348