BLASTX nr result
ID: Cimicifuga21_contig00005068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00005068 (518 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633645.1| PREDICTED: sucrose nonfermenting 4-like prot... 74 2e-11 ref|XP_002284480.1| PREDICTED: sucrose nonfermenting 4-like prot... 74 2e-11 ref|XP_002512390.1| AMP-activated protein kinase, gamma regulato... 72 5e-11 dbj|BAJ33729.1| unnamed protein product [Thellungiella halophila] 71 8e-11 gb|AAB70406.1| Contains similarity to Rattus AMP-activated prote... 71 1e-10 >ref|XP_003633645.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 2 [Vitis vinifera] gi|296088362|emb|CBI36807.3| unnamed protein product [Vitis vinifera] Length = 482 Score = 73.6 bits (179), Expect = 2e-11 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = +2 Query: 368 SIKGHIHLWSQAQVSSIPIVDDSGSLLDIYSRSDITALAKDRAYAQIHLN 517 S+ + L QA+VSSIPIVDD+ SLLDIYSRSDITALAKDRAYAQIHL+ Sbjct: 358 SLGAALSLLVQAEVSSIPIVDDNDSLLDIYSRSDITALAKDRAYAQIHLD 407 >ref|XP_002284480.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 1 [Vitis vinifera] Length = 488 Score = 73.6 bits (179), Expect = 2e-11 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = +2 Query: 368 SIKGHIHLWSQAQVSSIPIVDDSGSLLDIYSRSDITALAKDRAYAQIHLN 517 S+ + L QA+VSSIPIVDD+ SLLDIYSRSDITALAKDRAYAQIHL+ Sbjct: 364 SLGAALSLLVQAEVSSIPIVDDNDSLLDIYSRSDITALAKDRAYAQIHLD 413 >ref|XP_002512390.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] gi|223548351|gb|EEF49842.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] Length = 540 Score = 72.0 bits (175), Expect = 5e-11 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = +2 Query: 368 SIKGHIHLWSQAQVSSIPIVDDSGSLLDIYSRSDITALAKDRAYAQIHLN 517 S+ + L QA+VSSIPIVDD+ SLLDIYSRSDITALAKD+AYAQIHL+ Sbjct: 352 SLGDALSLLVQAEVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLD 401 >dbj|BAJ33729.1| unnamed protein product [Thellungiella halophila] Length = 487 Score = 71.2 bits (173), Expect = 8e-11 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +2 Query: 368 SIKGHIHLWSQAQVSSIPIVDDSGSLLDIYSRSDITALAKDRAYAQIHLN 517 S+ + L QA+VSSIP+VDD+ SL+DIYSRSDITALAKD+AYAQIHL+ Sbjct: 362 SLGSALSLLVQAEVSSIPVVDDNDSLIDIYSRSDITALAKDKAYAQIHLD 411 >gb|AAB70406.1| Contains similarity to Rattus AMP-activated protein kinase (gb|X95577) [Arabidopsis thaliana] Length = 391 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +2 Query: 368 SIKGHIHLWSQAQVSSIPIVDDSGSLLDIYSRSDITALAKDRAYAQIHLN 517 S+ + L QA+VSSIP+VDD+ SL+DIYSRSDITALAKD+AYAQIHL+ Sbjct: 291 SLGSALALLVQAEVSSIPVVDDNDSLIDIYSRSDITALAKDKAYAQIHLD 340