BLASTX nr result
ID: Cimicifuga21_contig00004858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00004858 (1250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004169842.1| PREDICTED: LOW QUALITY PROTEIN: exonuclease ... 73 2e-10 ref|XP_004147427.1| PREDICTED: exonuclease 1-like [Cucumis sativus] 73 2e-10 ref|NP_001117381.1| exonuclease 1 [Arabidopsis thaliana] gi|3321... 73 2e-10 ref|NP_174256.2| exonuclease 1 [Arabidopsis thaliana] gi|3321929... 73 2e-10 ref|NP_001077624.1| exonuclease 1 [Arabidopsis thaliana] gi|1662... 73 2e-10 >ref|XP_004169842.1| PREDICTED: LOW QUALITY PROTEIN: exonuclease 1-like [Cucumis sativus] Length = 685 Score = 72.8 bits (177), Expect = 2e-10 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 1/79 (1%) Frame = -3 Query: 720 RDLKYRD-KVPNDYQSNFEKTLLTYKHQRVFDRNLGDTVHFTEISANNYMDFDFLGPPLE 544 R L+Y VP+ Y+ +F+K +LT++HQRV+D D VH ++IS + D DFLGP + Sbjct: 254 RHLRYSTVAVPHLYEESFKKAILTFQHQRVYDPITEDIVHLSQISDHIEDDLDFLGPSIP 313 Query: 543 KELARKIAEGEVDPVTRKP 487 + +A+ IAEG++DP T P Sbjct: 314 QHIAKGIAEGDIDPCTNLP 332 >ref|XP_004147427.1| PREDICTED: exonuclease 1-like [Cucumis sativus] Length = 685 Score = 72.8 bits (177), Expect = 2e-10 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 1/79 (1%) Frame = -3 Query: 720 RDLKYRD-KVPNDYQSNFEKTLLTYKHQRVFDRNLGDTVHFTEISANNYMDFDFLGPPLE 544 R L+Y VP+ Y+ +F+K +LT++HQRV+D D VH ++IS + D DFLGP + Sbjct: 254 RHLRYSTVAVPHLYEESFKKAILTFQHQRVYDPITEDIVHLSQISDHIEDDLDFLGPSIP 313 Query: 543 KELARKIAEGEVDPVTRKP 487 + +A+ IAEG++DP T P Sbjct: 314 QHIAKGIAEGDIDPCTNLP 332 >ref|NP_001117381.1| exonuclease 1 [Arabidopsis thaliana] gi|332192992|gb|AEE31113.1| exonuclease 1 [Arabidopsis thaliana] Length = 581 Score = 72.8 bits (177), Expect = 2e-10 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 1/79 (1%) Frame = -3 Query: 720 RDLKYRD-KVPNDYQSNFEKTLLTYKHQRVFDRNLGDTVHFTEISANNYMDFDFLGPPLE 544 + LKY VP Y+ +F++ LLT+KHQRV+D N D +H +IS N D DF+GP + Sbjct: 100 KHLKYSTVSVPPLYEESFKRALLTFKHQRVYDPNAEDIIHLCDISDNLGEDSDFVGPSMP 159 Query: 543 KELARKIAEGEVDPVTRKP 487 +++A+ IA G++DP T+ P Sbjct: 160 QDIAKGIALGQLDPFTQLP 178 >ref|NP_174256.2| exonuclease 1 [Arabidopsis thaliana] gi|332192990|gb|AEE31111.1| exonuclease 1 [Arabidopsis thaliana] Length = 665 Score = 72.8 bits (177), Expect = 2e-10 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 1/79 (1%) Frame = -3 Query: 720 RDLKYRD-KVPNDYQSNFEKTLLTYKHQRVFDRNLGDTVHFTEISANNYMDFDFLGPPLE 544 + LKY VP Y+ +F++ LLT+KHQRV+D N D +H +IS N D DF+GP + Sbjct: 184 KHLKYSTVSVPPLYEESFKRALLTFKHQRVYDPNAEDIIHLCDISDNLGEDSDFVGPSMP 243 Query: 543 KELARKIAEGEVDPVTRKP 487 +++A+ IA G++DP T+ P Sbjct: 244 QDIAKGIALGQLDPFTQLP 262 >ref|NP_001077624.1| exonuclease 1 [Arabidopsis thaliana] gi|166232400|sp|Q8L6Z7.2|EXO1_ARATH RecName: Full=Exonuclease 1 gi|332192991|gb|AEE31112.1| exonuclease 1 [Arabidopsis thaliana] Length = 735 Score = 72.8 bits (177), Expect = 2e-10 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 1/79 (1%) Frame = -3 Query: 720 RDLKYRD-KVPNDYQSNFEKTLLTYKHQRVFDRNLGDTVHFTEISANNYMDFDFLGPPLE 544 + LKY VP Y+ +F++ LLT+KHQRV+D N D +H +IS N D DF+GP + Sbjct: 254 KHLKYSTVSVPPLYEESFKRALLTFKHQRVYDPNAEDIIHLCDISDNLGEDSDFVGPSMP 313 Query: 543 KELARKIAEGEVDPVTRKP 487 +++A+ IA G++DP T+ P Sbjct: 314 QDIAKGIALGQLDPFTQLP 332