BLASTX nr result
ID: Cimicifuga21_contig00004806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00004806 (463 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551948.1| PREDICTED: probable polyamine oxidase 2-like... 57 2e-06 ref|XP_002282970.1| PREDICTED: probable polyamine oxidase 2 [Vit... 57 2e-06 ref|XP_002521588.1| amine oxidase, putative [Ricinus communis] g... 57 2e-06 ref|XP_002306765.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002302123.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >ref|XP_003551948.1| PREDICTED: probable polyamine oxidase 2-like [Glycine max] Length = 490 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +3 Query: 3 ESRMRVLERYGELDLFHPVMGEESASVSVPLQISRM 110 + RMRVLERYGE+DLF PVMGEE AS+S+PLQISR+ Sbjct: 456 DCRMRVLERYGEVDLFQPVMGEE-ASLSIPLQISRL 490 >ref|XP_002282970.1| PREDICTED: probable polyamine oxidase 2 [Vitis vinifera] gi|302143503|emb|CBI22064.3| unnamed protein product [Vitis vinifera] Length = 490 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +3 Query: 3 ESRMRVLERYGELDLFHPVMGEESASVSVPLQISRM 110 E RMRVLERYGELDLF P MGEE+ S S+PLQISRM Sbjct: 456 ECRMRVLERYGELDLFQPAMGEET-SFSIPLQISRM 490 >ref|XP_002521588.1| amine oxidase, putative [Ricinus communis] gi|223539266|gb|EEF40859.1| amine oxidase, putative [Ricinus communis] Length = 491 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 ESRMRVLERYGELDLFHPVMGEESASVSVPLQISRM 110 + RMRVLERYGELDLF PVMGEE A+VSVPL ISRM Sbjct: 457 DCRMRVLERYGELDLFQPVMGEE-AAVSVPLLISRM 491 >ref|XP_002306765.1| predicted protein [Populus trichocarpa] gi|222856214|gb|EEE93761.1| predicted protein [Populus trichocarpa] Length = 482 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 3 ESRMRVLERYGELDLFHPVMGEESASVSVPLQISRM 110 + RMRVLERYGELDLF PVMG E A VSVPL ISR+ Sbjct: 447 DCRMRVLERYGELDLFQPVMGTEEAPVSVPLLISRI 482 >ref|XP_002302123.1| predicted protein [Populus trichocarpa] gi|222843849|gb|EEE81396.1| predicted protein [Populus trichocarpa] Length = 513 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 9 RMRVLERYGELDLFHPVMGEESASVSVPLQISRM 110 RMRVLERYGELD+F PVMGEE A+VSVPL ISRM Sbjct: 481 RMRVLERYGELDIFQPVMGEE-ATVSVPLLISRM 513