BLASTX nr result
ID: Cimicifuga21_contig00004358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00004358 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532153.1| proline-rich protein, putative [Ricinus comm... 56 3e-06 ref|XP_004161854.1| PREDICTED: uncharacterized LOC101206596 [Cuc... 56 3e-06 >ref|XP_002532153.1| proline-rich protein, putative [Ricinus communis] gi|223528163|gb|EEF30227.1| proline-rich protein, putative [Ricinus communis] Length = 331 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/36 (72%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = +1 Query: 85 MYQVGGSHLGPDFNNQGGGSMQGDRG-SWMPGPPEN 189 MYQ GGSHLG +FNNQGG SMQ DRG SWM PE+ Sbjct: 227 MYQAGGSHLGAEFNNQGGSSMQVDRGSSWMSSQPES 262 >ref|XP_004161854.1| PREDICTED: uncharacterized LOC101206596 [Cucumis sativus] Length = 399 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +1 Query: 85 MYQVGGSHLGPDFNNQGGGSMQGDRGSWMPGPPENLT 195 MYQ GGS LG +F NQ G S DRG WMPGPPEN T Sbjct: 292 MYQAGGSKLGTEFMNQVGTSKPADRGPWMPGPPENPT 328