BLASTX nr result
ID: Cimicifuga21_contig00003943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00003943 (527 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003613421.1| Disease resistance protein [Medicago truncat... 41 1e-06 >ref|XP_003613421.1| Disease resistance protein [Medicago truncatula] gi|355514756|gb|AES96379.1| Disease resistance protein [Medicago truncatula] Length = 1997 Score = 40.8 bits (94), Expect(2) = 1e-06 Identities = 19/47 (40%), Positives = 29/47 (61%) Frame = -2 Query: 523 VFPNLQYLLIRECHNLKSLFSFGMARHLQQLNHFQVDRCKNLEVIIA 383 +FPNL LLI C+ + LFS + L+ L +V +C+N+E II+ Sbjct: 1222 LFPNLTSLLIETCNKVNILFSHSIMCSLEHLQKLEVRQCENMEEIIS 1268 Score = 36.6 bits (83), Expect(2) = 1e-06 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 3/51 (5%) Frame = -3 Query: 291 EEEAMDHDGCFLPKLQSLHMEKLPNLRSIIQGNLPLTCPELR---MKDCPN 148 EE ++ LP LQ L ++KLP+L++ QG+ L P L ++DCPN Sbjct: 1271 EEIDATNNKIMLPALQHLLLKKLPSLKAFFQGHHNLDFPSLEKVDIEDCPN 1321