BLASTX nr result
ID: Cimicifuga21_contig00003650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00003650 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28706.3| unnamed protein product [Vitis vinifera] 105 3e-21 ref|XP_004139687.1| PREDICTED: 40S ribosomal protein S18-like [C... 103 2e-20 gb|ADR71282.1| 40S ribosomal protein S18C [Hevea brasiliensis] 103 2e-20 ref|XP_002520719.1| 40S ribosomal protein S18, putative [Ricinus... 103 2e-20 ref|XP_002524340.1| 40S ribosomal protein S18, putative [Ricinus... 103 2e-20 >emb|CBI28706.3| unnamed protein product [Vitis vinifera] Length = 912 Score = 105 bits (263), Expect = 3e-21 Identities = 53/60 (88%), Positives = 55/60 (91%) Frame = -1 Query: 181 RLLERQTLIMSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 2 R +TL MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD Sbjct: 752 RRASSETLTMSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 811 >ref|XP_004139687.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus] gi|449525091|ref|XP_004169553.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus] Length = 152 Score = 103 bits (256), Expect = 2e-20 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -1 Query: 154 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 2 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 51 >gb|ADR71282.1| 40S ribosomal protein S18C [Hevea brasiliensis] Length = 152 Score = 103 bits (256), Expect = 2e-20 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -1 Query: 154 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 2 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 51 >ref|XP_002520719.1| 40S ribosomal protein S18, putative [Ricinus communis] gi|223540104|gb|EEF41681.1| 40S ribosomal protein S18, putative [Ricinus communis] gi|313586541|gb|ADR71281.1| 40S ribosomal protein S18A [Hevea brasiliensis] Length = 152 Score = 103 bits (256), Expect = 2e-20 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -1 Query: 154 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 2 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 51 >ref|XP_002524340.1| 40S ribosomal protein S18, putative [Ricinus communis] gi|223536431|gb|EEF38080.1| 40S ribosomal protein S18, putative [Ricinus communis] Length = 152 Score = 103 bits (256), Expect = 2e-20 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -1 Query: 154 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 2 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVD 51