BLASTX nr result
ID: Cimicifuga21_contig00003638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00003638 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABA54870.1| putative chorismate synthase [Fagus sylvatica] 102 2e-20 gb|ACJ14000.1| embryo defective 1144 [Helianthus annuus] 102 3e-20 gb|ACJ13999.1| embryo defective 1144 [Helianthus annuus] gi|2119... 102 3e-20 gb|ACJ14021.1| embryo defective 1144 [Helianthus petiolaris] 100 2e-19 ref|XP_002529571.1| Chorismate synthase, chloroplast precursor, ... 99 3e-19 >gb|ABA54870.1| putative chorismate synthase [Fagus sylvatica] Length = 434 Score = 102 bits (255), Expect = 2e-20 Identities = 45/66 (68%), Positives = 56/66 (84%) Frame = -1 Query: 246 RQEVELMTRGRHDPCVVPRAVPMVEAMVALVLVDQLIGHHGQCQLFPINPAFQDPINLPK 67 ++E+EL+ RGRHDPCVVPRAVPMVEAMVALVL DQL+ + QC LFPINP Q+P +LP+ Sbjct: 367 KKEIELIARGRHDPCVVPRAVPMVEAMVALVLADQLMSQYAQCNLFPINPDLQEPFSLPR 426 Query: 66 LEPANL 49 EPA++ Sbjct: 427 FEPAHV 432 >gb|ACJ14000.1| embryo defective 1144 [Helianthus annuus] Length = 109 Score = 102 bits (254), Expect = 3e-20 Identities = 46/62 (74%), Positives = 54/62 (87%) Frame = -1 Query: 246 RQEVELMTRGRHDPCVVPRAVPMVEAMVALVLVDQLIGHHGQCQLFPINPAFQDPINLPK 67 ++E EL+ RGRHDPCVVPRAVPMVEA VALVL+DQL+ + QCQLFPINP FQ+P+ LPK Sbjct: 45 KKETELIARGRHDPCVVPRAVPMVEASVALVLMDQLLAQYAQCQLFPINPDFQEPLQLPK 104 Query: 66 LE 61 LE Sbjct: 105 LE 106 >gb|ACJ13999.1| embryo defective 1144 [Helianthus annuus] gi|211953679|gb|ACJ14001.1| embryo defective 1144 [Helianthus annuus] gi|211953681|gb|ACJ14002.1| embryo defective 1144 [Helianthus annuus] gi|211953683|gb|ACJ14003.1| embryo defective 1144 [Helianthus annuus] gi|211953685|gb|ACJ14004.1| embryo defective 1144 [Helianthus annuus] gi|211953687|gb|ACJ14005.1| embryo defective 1144 [Helianthus annuus] gi|211953689|gb|ACJ14006.1| embryo defective 1144 [Helianthus annuus] gi|211953691|gb|ACJ14007.1| embryo defective 1144 [Helianthus annuus] gi|211953693|gb|ACJ14008.1| embryo defective 1144 [Helianthus annuus] gi|211953695|gb|ACJ14009.1| embryo defective 1144 [Helianthus annuus] gi|211953697|gb|ACJ14010.1| embryo defective 1144 [Helianthus annuus] gi|211953699|gb|ACJ14011.1| embryo defective 1144 [Helianthus annuus] gi|211953701|gb|ACJ14012.1| embryo defective 1144 [Helianthus annuus] gi|211953703|gb|ACJ14013.1| embryo defective 1144 [Helianthus annuus] gi|211953705|gb|ACJ14014.1| embryo defective 1144 [Helianthus annuus] gi|211953707|gb|ACJ14015.1| embryo defective 1144 [Helianthus annuus] gi|211953709|gb|ACJ14016.1| embryo defective 1144 [Helianthus annuus] gi|211953711|gb|ACJ14017.1| embryo defective 1144 [Helianthus annuus] gi|211953713|gb|ACJ14018.1| embryo defective 1144 [Helianthus annuus] gi|211953715|gb|ACJ14019.1| embryo defective 1144 [Helianthus annuus] gi|211953717|gb|ACJ14020.1| embryo defective 1144 [Helianthus annuus] gi|211953721|gb|ACJ14022.1| embryo defective 1144 [Helianthus petiolaris] Length = 109 Score = 102 bits (254), Expect = 3e-20 Identities = 46/62 (74%), Positives = 54/62 (87%) Frame = -1 Query: 246 RQEVELMTRGRHDPCVVPRAVPMVEAMVALVLVDQLIGHHGQCQLFPINPAFQDPINLPK 67 ++E EL+ RGRHDPCVVPRAVPMVEA VALVL+DQL+ + QCQLFPINP FQ+P+ LPK Sbjct: 45 KKETELIARGRHDPCVVPRAVPMVEASVALVLMDQLLAQYAQCQLFPINPDFQEPLQLPK 104 Query: 66 LE 61 LE Sbjct: 105 LE 106 >gb|ACJ14021.1| embryo defective 1144 [Helianthus petiolaris] Length = 109 Score = 100 bits (248), Expect = 2e-19 Identities = 45/62 (72%), Positives = 53/62 (85%) Frame = -1 Query: 246 RQEVELMTRGRHDPCVVPRAVPMVEAMVALVLVDQLIGHHGQCQLFPINPAFQDPINLPK 67 ++E EL+ RGRHDPCVVPRAVPMVEA VALVL+DQL+ + QCQLFPIN FQ+P+ LPK Sbjct: 45 KKETELIARGRHDPCVVPRAVPMVEASVALVLIDQLLAQYAQCQLFPINSDFQEPLQLPK 104 Query: 66 LE 61 LE Sbjct: 105 LE 106 >ref|XP_002529571.1| Chorismate synthase, chloroplast precursor, putative [Ricinus communis] gi|223530947|gb|EEF32805.1| Chorismate synthase, chloroplast precursor, putative [Ricinus communis] Length = 435 Score = 99.4 bits (246), Expect = 3e-19 Identities = 44/65 (67%), Positives = 53/65 (81%) Frame = -1 Query: 240 EVELMTRGRHDPCVVPRAVPMVEAMVALVLVDQLIGHHGQCQLFPINPAFQDPINLPKLE 61 E EL+ RGRHDPCVVPRAVPMVEAMVALVLVDQL+ + QC +FPINP Q+P+ LP+ E Sbjct: 370 ETELIARGRHDPCVVPRAVPMVEAMVALVLVDQLMAQYAQCYMFPINPELQEPLKLPRAE 429 Query: 60 PANLS 46 N++ Sbjct: 430 SVNMT 434