BLASTX nr result
ID: Cimicifuga21_contig00003601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00003601 (376 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20322.3| unnamed protein product [Vitis vinifera] 66 3e-09 ref|XP_002282230.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 ref|XP_003632962.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 emb|CAN64166.1| hypothetical protein VITISV_006333 [Vitis vinifera] 57 2e-06 >emb|CBI20322.3| unnamed protein product [Vitis vinifera] Length = 687 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = +3 Query: 6 VEEVETFVEALKAISPMDKNMYHSLIKAKLRAGKDVEELLESMKA 140 VEEVETFV ALKA+ PMD+ MYH+ I+A +RAGK+V+ +L+SMKA Sbjct: 439 VEEVETFVSALKAVIPMDREMYHAQIRASIRAGKEVDGILDSMKA 483 >ref|XP_002282230.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial [Vitis vinifera] Length = 504 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = +3 Query: 6 VEEVETFVEALKAISPMDKNMYHSLIKAKLRAGKDVEELLESMKA 140 VEEVETFV ALKA+ PMD+ MYH+ I+A +RAGK+V+ +L+SMKA Sbjct: 439 VEEVETFVSALKAVIPMDREMYHAQIRASIRAGKEVDGILDSMKA 483 >ref|XP_003632962.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Vitis vinifera] Length = 506 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/46 (56%), Positives = 37/46 (80%) Frame = +3 Query: 3 QVEEVETFVEALKAISPMDKNMYHSLIKAKLRAGKDVEELLESMKA 140 +VE+VE FV +L+ + PM++ MYH+LI A +RAGK+V+ LL SMKA Sbjct: 441 RVEDVEAFVGSLRIVIPMNRRMYHTLIMANIRAGKEVDGLLASMKA 486 >emb|CAN64166.1| hypothetical protein VITISV_006333 [Vitis vinifera] Length = 506 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/46 (56%), Positives = 37/46 (80%) Frame = +3 Query: 3 QVEEVETFVEALKAISPMDKNMYHSLIKAKLRAGKDVEELLESMKA 140 +VE+VE FV +L+ + PM++ MYH+LI A +RAGK+V+ LL SMKA Sbjct: 441 RVEDVEAFVGSLRIVIPMNRRMYHTLIMANIRAGKEVDGLLASMKA 486