BLASTX nr result
ID: Cimicifuga21_contig00003336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00003336 (674 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515850.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_002515850.1| conserved hypothetical protein [Ricinus communis] gi|223545005|gb|EEF46519.1| conserved hypothetical protein [Ricinus communis] Length = 284 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -2 Query: 454 AEESKLLCNRVRVYPRKPNMKFDKGVTVVPISDDQWVAV 338 A ES LLC RVR+YP PN+ F KG+TV+PI+D+ WVAV Sbjct: 236 APESYLLCERVRMYPSYPNIDFPKGITVLPITDNIWVAV 274