BLASTX nr result
ID: Cimicifuga21_contig00003175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00003175 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307616.1| predicted protein [Populus trichocarpa] gi|2... 93 2e-17 ref|XP_002300812.1| predicted protein [Populus trichocarpa] gi|2... 92 4e-17 ref|XP_002520966.1| RNA binding protein, putative [Ricinus commu... 82 6e-14 ref|XP_002463742.1| hypothetical protein SORBIDRAFT_01g005220 [S... 81 1e-13 gb|EAY92179.1| hypothetical protein OsI_13894 [Oryza sativa Indi... 81 1e-13 >ref|XP_002307616.1| predicted protein [Populus trichocarpa] gi|222857065|gb|EEE94612.1| predicted protein [Populus trichocarpa] Length = 379 Score = 93.2 bits (230), Expect = 2e-17 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -1 Query: 316 HAYRLTMRALYASGPLSWEQESLLTNLRLSLHISNEEHLLHLKQLLSAQVL 164 HAYR T++ALYASGPLSWEQESLLTNLRLSLHIS+EEHLLHL+QLLS QVL Sbjct: 329 HAYRSTVQALYASGPLSWEQESLLTNLRLSLHISDEEHLLHLRQLLSTQVL 379 >ref|XP_002300812.1| predicted protein [Populus trichocarpa] gi|222842538|gb|EEE80085.1| predicted protein [Populus trichocarpa] Length = 394 Score = 92.0 bits (227), Expect = 4e-17 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = -1 Query: 316 HAYRLTMRALYASGPLSWEQESLLTNLRLSLHISNEEHLLHLKQLLSAQVL*SS 155 HAYR T++ALYASGPLSWEQESLLTNLRLSL+IS+EEHLLHL+QLLS QVL SS Sbjct: 333 HAYRSTVQALYASGPLSWEQESLLTNLRLSLNISDEEHLLHLRQLLSTQVLQSS 386 >ref|XP_002520966.1| RNA binding protein, putative [Ricinus communis] gi|223539803|gb|EEF41383.1| RNA binding protein, putative [Ricinus communis] Length = 383 Score = 81.6 bits (200), Expect = 6e-14 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 313 AYRLTMRALYASGPLSWEQESLLTNLRLSLHISNEEHLLHLKQLLS 176 AY+ T+RALYASGPLSWEQESLLTNLRLSLHIS+EEHLL LK LLS Sbjct: 337 AYKSTVRALYASGPLSWEQESLLTNLRLSLHISDEEHLLQLKHLLS 382 >ref|XP_002463742.1| hypothetical protein SORBIDRAFT_01g005220 [Sorghum bicolor] gi|241917596|gb|EER90740.1| hypothetical protein SORBIDRAFT_01g005220 [Sorghum bicolor] Length = 307 Score = 80.9 bits (198), Expect = 1e-13 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -1 Query: 313 AYRLTMRALYASGPLSWEQESLLTNLRLSLHISNEEHLLHLKQLLSA 173 AYR TMRALYASGPL+WEQE+LLTNLRLSL+ISNEEHLL L++LLS+ Sbjct: 261 AYRSTMRALYASGPLTWEQEALLTNLRLSLNISNEEHLLQLRRLLSS 307 >gb|EAY92179.1| hypothetical protein OsI_13894 [Oryza sativa Indica Group] Length = 817 Score = 80.9 bits (198), Expect = 1e-13 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -1 Query: 313 AYRLTMRALYASGPLSWEQESLLTNLRLSLHISNEEHLLHLKQLLSAQ 170 AY+ TMRALYASGPL+WEQESLLTNLRLSL+ISNEEHLL L++LLS++ Sbjct: 770 AYQSTMRALYASGPLTWEQESLLTNLRLSLNISNEEHLLQLRRLLSSR 817