BLASTX nr result
ID: Cimicifuga21_contig00002449
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00002449 (617 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003523882.1| PREDICTED: allene oxide synthase, chloroplas... 57 3e-06 >ref|XP_003523882.1| PREDICTED: allene oxide synthase, chloroplastic-like [Glycine max] Length = 491 Score = 57.0 bits (136), Expect = 3e-06 Identities = 39/101 (38%), Positives = 48/101 (47%), Gaps = 19/101 (18%) Frame = +2 Query: 371 PVALPIQKIPGDYGFPFFGPIKDRL------SRGVFLISSSKIQLNCV----QTPRSLSF 520 P LP++KIPGDYG PF GPIKDRL R F S ++ + V P Sbjct: 23 PSKLPMRKIPGDYGLPFIGPIKDRLDFFYNQGRDKFFQSRAQKYNSTVFRANMPPGPFIA 82 Query: 521 SMPRA---------SLFSSTSLKSKRDLFTGTYIPSLTLTG 616 S P + S KRD+FTGT++PS LTG Sbjct: 83 SNPNVIVLLDAKSFPVLFDVSKVEKRDVFTGTFMPSTQLTG 123