BLASTX nr result
ID: Cimicifuga21_contig00002392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00002392 (561 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEO33608.1| hypothetical protein [Amblyomma maculatum] 55 6e-06 >gb|AEO33608.1| hypothetical protein [Amblyomma maculatum] Length = 169 Score = 55.5 bits (132), Expect = 6e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +2 Query: 395 VPIMVDEDEPEEIFFRRFQREVSKARVIQERKRRRYFEN 511 V I+VDE+E +E RRF+REVSKA VIQE KRRR+FEN Sbjct: 88 VQIVVDEEESDEALLRRFRREVSKAGVIQECKRRRFFEN 126