BLASTX nr result
ID: Cimicifuga21_contig00002269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00002269 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004163979.1| PREDICTED: lon protease homolog 2, peroxisom... 86 4e-15 ref|XP_004150167.1| PREDICTED: lon protease homolog 2, peroxisom... 86 4e-15 ref|XP_003517387.1| PREDICTED: lon protease homolog 2, peroxisom... 82 3e-14 ref|XP_002528799.1| ATP-dependent protease La, putative [Ricinus... 82 3e-14 ref|XP_002282657.1| PREDICTED: lon protease homolog 2, peroxisom... 81 1e-13 >ref|XP_004163979.1| PREDICTED: lon protease homolog 2, peroxisomal-like, partial [Cucumis sativus] Length = 816 Score = 85.5 bits (210), Expect = 4e-15 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -3 Query: 424 PERNVKELVEVPSHVLASLEILLAQRMEHVLEQAFEGGCPWRMHAKL 284 PERN+K+LVEVPS VLASLEILLA+RME VLEQAFEGGCPWR+H+KL Sbjct: 770 PERNLKDLVEVPSGVLASLEILLAKRMEDVLEQAFEGGCPWRLHSKL 816 >ref|XP_004150167.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Cucumis sativus] Length = 886 Score = 85.5 bits (210), Expect = 4e-15 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -3 Query: 424 PERNVKELVEVPSHVLASLEILLAQRMEHVLEQAFEGGCPWRMHAKL 284 PERN+K+LVEVPS VLASLEILLA+RME VLEQAFEGGCPWR+H+KL Sbjct: 840 PERNLKDLVEVPSGVLASLEILLAKRMEDVLEQAFEGGCPWRLHSKL 886 >ref|XP_003517387.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Glycine max] Length = 889 Score = 82.4 bits (202), Expect = 3e-14 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -3 Query: 424 PERNVKELVEVPSHVLASLEILLAQRMEHVLEQAFEGGCPWRMHAKL 284 PERN+K+LVEVPS VLA LEILLA+RME VLEQAF+GGCPWR H+KL Sbjct: 843 PERNLKDLVEVPSSVLADLEILLAKRMEDVLEQAFDGGCPWRQHSKL 889 >ref|XP_002528799.1| ATP-dependent protease La, putative [Ricinus communis] gi|223531802|gb|EEF33621.1| ATP-dependent protease La, putative [Ricinus communis] Length = 890 Score = 82.4 bits (202), Expect = 3e-14 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = -3 Query: 424 PERNVKELVEVPSHVLASLEILLAQRMEHVLEQAFEGGCPWRMHAKL 284 PERN+K+LVEVP+ VL SLEILLA+RME VLEQAFEGGCPWR+H+KL Sbjct: 844 PERNLKDLVEVPAAVLGSLEILLAKRMEDVLEQAFEGGCPWRIHSKL 890 >ref|XP_002282657.1| PREDICTED: lon protease homolog 2, peroxisomal [Vitis vinifera] gi|297742183|emb|CBI33970.3| unnamed protein product [Vitis vinifera] Length = 888 Score = 80.9 bits (198), Expect = 1e-13 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -3 Query: 424 PERNVKELVEVPSHVLASLEILLAQRMEHVLEQAFEGGCPWRMHAKL 284 PERN+K+LVEVPS VLASLEILLA+RME VLEQAFEGGCPWR +KL Sbjct: 842 PERNLKDLVEVPSAVLASLEILLAKRMEDVLEQAFEGGCPWRRDSKL 888