BLASTX nr result
ID: Cimicifuga21_contig00001212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00001212 (447 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24313.3| unnamed protein product [Vitis vinifera] 180 9e-44 ref|XP_002267829.1| PREDICTED: pentatricopeptide repeat-containi... 180 9e-44 ref|XP_002523226.1| pentatricopeptide repeat-containing protein,... 165 3e-39 ref|XP_002868306.1| pentatricopeptide repeat-containing protein ... 161 6e-38 ref|NP_193153.3| pentatricopeptide repeat-containing protein [Ar... 154 6e-36 >emb|CBI24313.3| unnamed protein product [Vitis vinifera] Length = 407 Score = 180 bits (457), Expect = 9e-44 Identities = 84/114 (73%), Positives = 99/114 (86%) Frame = +3 Query: 6 MKDYGVVAELKHYACMVDCLGKAGLIEEAEKFIEEMPVEPDGAVLGALLGGCRVHGNIEV 185 MK+YGV ELKHYACMVDCLG+AG++E+AE+FIEEMPVE DGAVLGALLGGCRVHGN EV Sbjct: 290 MKEYGVAPELKHYACMVDCLGRAGMLEDAERFIEEMPVEADGAVLGALLGGCRVHGNAEV 349 Query: 186 AERVAKKLLRLEPERGGYYVLLANIYAESGRYGDAEKIWDFMKRKNVSKVPGCS 347 ERVAKKL+ LEPE+ YV+LANIYA +GR+ DAEK+ MK++ +SKVPGCS Sbjct: 350 GERVAKKLMGLEPEKASNYVMLANIYAGAGRFEDAEKVRQLMKQRKLSKVPGCS 403 >ref|XP_002267829.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14170-like [Vitis vinifera] Length = 455 Score = 180 bits (457), Expect = 9e-44 Identities = 84/114 (73%), Positives = 99/114 (86%) Frame = +3 Query: 6 MKDYGVVAELKHYACMVDCLGKAGLIEEAEKFIEEMPVEPDGAVLGALLGGCRVHGNIEV 185 MK+YGV ELKHYACMVDCLG+AG++E+AE+FIEEMPVE DGAVLGALLGGCRVHGN EV Sbjct: 338 MKEYGVAPELKHYACMVDCLGRAGMLEDAERFIEEMPVEADGAVLGALLGGCRVHGNAEV 397 Query: 186 AERVAKKLLRLEPERGGYYVLLANIYAESGRYGDAEKIWDFMKRKNVSKVPGCS 347 ERVAKKL+ LEPE+ YV+LANIYA +GR+ DAEK+ MK++ +SKVPGCS Sbjct: 398 GERVAKKLMGLEPEKASNYVMLANIYAGAGRFEDAEKVRQLMKQRKLSKVPGCS 451 >ref|XP_002523226.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537522|gb|EEF39147.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 488 Score = 165 bits (418), Expect = 3e-39 Identities = 75/114 (65%), Positives = 97/114 (85%) Frame = +3 Query: 6 MKDYGVVAELKHYACMVDCLGKAGLIEEAEKFIEEMPVEPDGAVLGALLGGCRVHGNIEV 185 M++YG+VAEL+HYA +VDCL +AG EEAEKFI ++P+EPD AVLGA+L GCRVH N+EV Sbjct: 367 MQNYGLVAELRHYATIVDCLARAGRFEEAEKFISDIPMEPDEAVLGAILAGCRVHNNVEV 426 Query: 186 AERVAKKLLRLEPERGGYYVLLANIYAESGRYGDAEKIWDFMKRKNVSKVPGCS 347 ER+AK+L+RL+PE+ GYYVLLAN+YA GR+ +AE + D M+ KN+SKVPGCS Sbjct: 427 GERIAKRLIRLKPEKAGYYVLLANMYAGVGRFHEAEMVRDSMQEKNMSKVPGCS 480 >ref|XP_002868306.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297314142|gb|EFH44565.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 458 Score = 161 bits (407), Expect = 6e-38 Identities = 71/116 (61%), Positives = 95/116 (81%) Frame = +3 Query: 6 MKDYGVVAELKHYACMVDCLGKAGLIEEAEKFIEEMPVEPDGAVLGALLGGCRVHGNIEV 185 M++Y +V ELKHYA + DC+ +AGL+EEAEKF+E+MPVEPD AVLGA+L GC+V+GN+EV Sbjct: 343 MQEYKIVPELKHYASVADCMSRAGLLEEAEKFLEDMPVEPDEAVLGAVLSGCKVYGNVEV 402 Query: 186 AERVAKKLLRLEPERGGYYVLLANIYAESGRYGDAEKIWDFMKRKNVSKVPGCSQI 353 ERVA+KL++LEP +G YYV LA +Y+ +GR+ +AE + MK K +SKVPGCS I Sbjct: 403 GERVARKLIQLEPRKGSYYVTLAGLYSAAGRFDEAESLRQLMKEKQISKVPGCSSI 458 >ref|NP_193153.3| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635637|sp|Q5XEY7.2|PP309_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g14170 gi|332657989|gb|AEE83389.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 477 Score = 154 bits (390), Expect = 6e-36 Identities = 66/116 (56%), Positives = 95/116 (81%) Frame = +3 Query: 6 MKDYGVVAELKHYACMVDCLGKAGLIEEAEKFIEEMPVEPDGAVLGALLGGCRVHGNIEV 185 M++Y +V ELKHYA + DC+ +AGL+EEAEKF+E+MPV+PD AV+GA+L GC+V+GN+EV Sbjct: 362 MQEYNIVPELKHYASVADCMSRAGLLEEAEKFLEDMPVKPDEAVMGAVLSGCKVYGNVEV 421 Query: 186 AERVAKKLLRLEPERGGYYVLLANIYAESGRYGDAEKIWDFMKRKNVSKVPGCSQI 353 ERVA++L++L+P + YYV LA +Y+ +GR+ +AE + +MK K +SKVPGCS I Sbjct: 422 GERVARELIQLKPRKASYYVTLAGLYSAAGRFDEAESLRQWMKEKQISKVPGCSSI 477