BLASTX nr result
ID: Cimicifuga21_contig00000992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00000992 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P32980.1|ATPD_TOBAC RecName: Full=ATP synthase delta chain, c... 55 8e-06 >sp|P32980.1|ATPD_TOBAC RecName: Full=ATP synthase delta chain, chloroplastic; AltName: Full=F-ATPase delta chain; Flags: Precursor gi|19787|emb|CAA45153.1| chloroplast ATP synthase (delta subunit) [Nicotiana tabacum] Length = 248 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/37 (64%), Positives = 34/37 (91%) Frame = -1 Query: 112 YASAIAEIAKSNGTLEETSSELEKIEKLFAETAIFNF 2 YA+A+A+IAKSNGTLE+T+++LEKIEK+ + A+FNF Sbjct: 69 YANALADIAKSNGTLEQTTADLEKIEKISDDEAVFNF 105