BLASTX nr result
ID: Cimicifuga21_contig00000566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00000566 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306562.1| predicted protein [Populus trichocarpa] gi|2... 87 2e-15 ref|XP_002308991.1| predicted protein [Populus trichocarpa] gi|2... 86 3e-15 emb|CBI19201.3| unnamed protein product [Vitis vinifera] 83 2e-14 ref|XP_002513969.1| conserved hypothetical protein [Ricinus comm... 83 2e-14 ref|XP_002285745.1| PREDICTED: 39S ribosomal protein L41-A, mito... 83 2e-14 >ref|XP_002306562.1| predicted protein [Populus trichocarpa] gi|222856011|gb|EEE93558.1| predicted protein [Populus trichocarpa] Length = 92 Score = 86.7 bits (213), Expect = 2e-15 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 138 MPLGLIQGIGRAMRRKRTSSLDILSSKRAPRDYYKGKNCKPTG 266 MPLGLI GIGRAMRRKRTSSLDILSSKRAPR+YYKGKNCKPTG Sbjct: 1 MPLGLITGIGRAMRRKRTSSLDILSSKRAPRNYYKGKNCKPTG 43 >ref|XP_002308991.1| predicted protein [Populus trichocarpa] gi|222854967|gb|EEE92514.1| predicted protein [Populus trichocarpa] Length = 92 Score = 85.9 bits (211), Expect = 3e-15 Identities = 41/43 (95%), Positives = 41/43 (95%) Frame = +3 Query: 138 MPLGLIQGIGRAMRRKRTSSLDILSSKRAPRDYYKGKNCKPTG 266 MPLGLI GIGRAMRRKRTSSLDILSSKRAPR YYKGKNCKPTG Sbjct: 1 MPLGLITGIGRAMRRKRTSSLDILSSKRAPRTYYKGKNCKPTG 43 >emb|CBI19201.3| unnamed protein product [Vitis vinifera] Length = 175 Score = 83.2 bits (204), Expect = 2e-14 Identities = 40/43 (93%), Positives = 40/43 (93%) Frame = +3 Query: 138 MPLGLIQGIGRAMRRKRTSSLDILSSKRAPRDYYKGKNCKPTG 266 M LGLI GIGRA RRKRTSSLDILSSKRAPRDYYKGKNCKPTG Sbjct: 79 MALGLILGIGRAFRRKRTSSLDILSSKRAPRDYYKGKNCKPTG 121 >ref|XP_002513969.1| conserved hypothetical protein [Ricinus communis] gi|223547055|gb|EEF48552.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 83.2 bits (204), Expect = 2e-14 Identities = 40/43 (93%), Positives = 40/43 (93%) Frame = +3 Query: 138 MPLGLIQGIGRAMRRKRTSSLDILSSKRAPRDYYKGKNCKPTG 266 M LGLI GIGRA RRKRTSSLDILSSKRAPRDYYKGKNCKPTG Sbjct: 1 MALGLILGIGRAFRRKRTSSLDILSSKRAPRDYYKGKNCKPTG 43 >ref|XP_002285745.1| PREDICTED: 39S ribosomal protein L41-A, mitochondrial [Vitis vinifera] gi|147843318|emb|CAN82662.1| hypothetical protein VITISV_004928 [Vitis vinifera] Length = 97 Score = 83.2 bits (204), Expect = 2e-14 Identities = 40/43 (93%), Positives = 40/43 (93%) Frame = +3 Query: 138 MPLGLIQGIGRAMRRKRTSSLDILSSKRAPRDYYKGKNCKPTG 266 M LGLI GIGRA RRKRTSSLDILSSKRAPRDYYKGKNCKPTG Sbjct: 1 MALGLILGIGRAFRRKRTSSLDILSSKRAPRDYYKGKNCKPTG 43