BLASTX nr result
ID: Cimicifuga21_contig00000299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00000299 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004161600.1| PREDICTED: putative prolyl 4-hydroxylase-lik... 55 8e-06 ref|XP_004152082.1| PREDICTED: putative prolyl 4-hydroxylase-lik... 55 8e-06 >ref|XP_004161600.1| PREDICTED: putative prolyl 4-hydroxylase-like [Cucumis sativus] Length = 137 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -1 Query: 113 VMDSTKIIFGLLTFVTIGMIIGALFQLAFIRRLEET 6 V +I+FGLLTFVT+GMIIGAL QLAF+RRLE++ Sbjct: 2 VSSQMRIVFGLLTFVTVGMIIGALLQLAFLRRLEDS 37 >ref|XP_004152082.1| PREDICTED: putative prolyl 4-hydroxylase-like [Cucumis sativus] Length = 290 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -1 Query: 113 VMDSTKIIFGLLTFVTIGMIIGALFQLAFIRRLEET 6 V +I+FGLLTFVT+GMIIGAL QLAF+RRLE++ Sbjct: 2 VSSQMRIVFGLLTFVTVGMIIGALLQLAFLRRLEDS 37