BLASTX nr result
ID: Cimicifuga21_contig00000289
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00000289 (389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269484.1| PREDICTED: bidirectional sugar transporter S... 86 4e-15 ref|XP_003635940.1| Protein RUPTURED POLLEN GRAIN [Medicago trun... 81 8e-14 ref|XP_002285636.1| PREDICTED: bidirectional sugar transporter S... 81 1e-13 ref|XP_003546637.1| PREDICTED: bidirectional sugar transporter S... 79 5e-13 ref|XP_004162108.1| PREDICTED: bidirectional sugar transporter S... 78 6e-13 >ref|XP_002269484.1| PREDICTED: bidirectional sugar transporter SWEET2a [Vitis vinifera] gi|297740590|emb|CBI30772.3| unnamed protein product [Vitis vinifera] Length = 232 Score = 85.5 bits (210), Expect = 4e-15 Identities = 42/58 (72%), Positives = 48/58 (82%), Gaps = 2/58 (3%) Frame = -2 Query: 388 LMSISFFAYGMLKKDGFIYVPNGIGTVLGIVQLLLYSYYSRTSRED--KRESLIAAYA 221 LMS+SFF YGM K D FIYVPNGIGT+LG+VQL+LY+YYSRTS ED RES I +YA Sbjct: 175 LMSLSFFTYGMFKHDPFIYVPNGIGTILGVVQLVLYAYYSRTSTEDLGLRESFIESYA 232 >ref|XP_003635940.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula] gi|355501875|gb|AES83078.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula] gi|388509868|gb|AFK43000.1| unknown [Medicago truncatula] Length = 235 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/55 (67%), Positives = 44/55 (80%) Frame = -2 Query: 388 LMSISFFAYGMLKKDGFIYVPNGIGTVLGIVQLLLYSYYSRTSREDKRESLIAAY 224 LMSISFF YG+L D FIYVPNGIGTVLG++QL+LY YY R+S +D E LI +Y Sbjct: 180 LMSISFFLYGLLSDDAFIYVPNGIGTVLGMIQLILYFYYKRSSSDDSTEPLIVSY 234 >ref|XP_002285636.1| PREDICTED: bidirectional sugar transporter SWEET2 [Vitis vinifera] gi|302142809|emb|CBI20104.3| unnamed protein product [Vitis vinifera] Length = 235 Score = 80.9 bits (198), Expect = 1e-13 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = -2 Query: 388 LMSISFFAYGMLKKDGFIYVPNGIGTVLGIVQLLLYSYYSRTSREDKRESLIAAY 224 LMS SF AYG+L D F+YVPNG GTVLGIVQL LYSYY RTS E+ RE LI +Y Sbjct: 180 LMSASFLAYGILNNDPFVYVPNGAGTVLGIVQLGLYSYYKRTSAEESREPLIVSY 234 >ref|XP_003546637.1| PREDICTED: bidirectional sugar transporter SWEET2-like [Glycine max] Length = 235 Score = 78.6 bits (192), Expect = 5e-13 Identities = 37/55 (67%), Positives = 43/55 (78%) Frame = -2 Query: 388 LMSISFFAYGMLKKDGFIYVPNGIGTVLGIVQLLLYSYYSRTSREDKRESLIAAY 224 LMS SFF YG+L D FIYVPNGIGTVLGI+QL+LY YY +S E+ RE LI +Y Sbjct: 180 LMSFSFFLYGLLSDDAFIYVPNGIGTVLGIIQLVLYFYYKGSSSEECREPLIVSY 234 >ref|XP_004162108.1| PREDICTED: bidirectional sugar transporter SWEET2-like [Cucumis sativus] Length = 233 Score = 78.2 bits (191), Expect = 6e-13 Identities = 36/56 (64%), Positives = 44/56 (78%) Frame = -2 Query: 388 LMSISFFAYGMLKKDGFIYVPNGIGTVLGIVQLLLYSYYSRTSREDKRESLIAAYA 221 LMSISFF YG+ D F+Y PNGIGT+LG VQL+LY Y+SR +RE+ RE LI +YA Sbjct: 178 LMSISFFLYGLFNYDLFVYAPNGIGTLLGSVQLVLYCYFSRVAREESREPLIVSYA 233