BLASTX nr result
ID: Chrysanthemum22_contig00051482
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00051482 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023771226.1| pentatricopeptide repeat-containing protein ... 105 2e-23 ref|XP_021989174.1| pentatricopeptide repeat-containing protein ... 103 5e-23 gb|KVG17891.1| Pentatricopeptide repeat-containing protein [Cyna... 101 4e-22 gb|OVA17328.1| Pentatricopeptide repeat [Macleaya cordata] 94 2e-19 ref|XP_010097931.1| pentatricopeptide repeat-containing protein ... 93 3e-19 ref|XP_010258005.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-18 gb|PON57014.1| DYW domain containing protein [Parasponia anderso... 89 9e-18 gb|ATP73680.1| hypothetical protein 2_9455_01, partial [Pinus sy... 84 2e-17 ref|XP_004137884.2| PREDICTED: pentatricopeptide repeat-containi... 88 2e-17 ref|XP_008465161.1| PREDICTED: pentatricopeptide repeat-containi... 88 2e-17 gb|AFG61376.1| hypothetical protein 0_7614_01, partial [Pinus ta... 82 2e-17 gb|AEW07637.1| hypothetical protein 0_7614_01, partial [Pinus ra... 82 2e-17 ref|XP_022158739.1| pentatricopeptide repeat-containing protein ... 88 2e-17 ref|XP_021890813.1| putative pentatricopeptide repeat-containing... 87 3e-17 dbj|GAV82594.1| PPR domain-containing protein/DYW_deaminase doma... 87 6e-17 gb|ATP73690.1| hypothetical protein 2_9455_01, partial [Pinus sy... 82 8e-17 gb|AFG65809.1| hypothetical protein 2_9455_01, partial [Pinus ta... 82 8e-17 gb|AFG65804.1| hypothetical protein 2_9455_01, partial [Pinus ta... 82 8e-17 gb|AEW08424.1| hypothetical protein 2_9455_01, partial [Pinus ra... 82 8e-17 ref|XP_007227177.1| pentatricopeptide repeat-containing protein ... 86 1e-16 >ref|XP_023771226.1| pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Lactuca sativa] gb|PLY79732.1| hypothetical protein LSAT_5X83301 [Lactuca sativa] Length = 663 Score = 105 bits (261), Expect = 2e-23 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 T+RVTKN RVCH CHEA KYISKVVGREIILKDPNRFHHF+NG+CSCQDFY Sbjct: 613 TVRVTKNLRVCHRCHEAVKYISKVVGREIILKDPNRFHHFKNGVCSCQDFY 663 >ref|XP_021989174.1| pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Helianthus annuus] gb|OTG11862.1| putative tetratricopeptide-like helical domain, DYW domain protein [Helianthus annuus] Length = 656 Score = 103 bits (258), Expect = 5e-23 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 TIRVTKN RVCHSCHEAAKYISKVV REIILKDPNRFHHF+NG CSCQD+Y Sbjct: 606 TIRVTKNLRVCHSCHEAAKYISKVVSREIILKDPNRFHHFKNGTCSCQDYY 656 >gb|KVG17891.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 663 Score = 101 bits (251), Expect = 4e-22 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 T+RVTKN RVCHSCHEAAKYISKVV REIILKDPN FHHF+NGICSCQD Y Sbjct: 613 TVRVTKNLRVCHSCHEAAKYISKVVSREIILKDPNCFHHFKNGICSCQDLY 663 >gb|OVA17328.1| Pentatricopeptide repeat [Macleaya cordata] Length = 666 Score = 93.6 bits (231), Expect = 2e-19 Identities = 38/51 (74%), Positives = 48/51 (94%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 T+R+TKN RVCH+CH +AK ISK+VGREIILKDP+RFHHF++GICSC+DF+ Sbjct: 616 TLRITKNLRVCHNCHSSAKMISKIVGREIILKDPDRFHHFKDGICSCEDFW 666 >ref|XP_010097931.1| pentatricopeptide repeat-containing protein DOT4, chloroplastic [Morus notabilis] gb|EXB73287.1| hypothetical protein L484_009366 [Morus notabilis] Length = 676 Score = 93.2 bits (230), Expect = 3e-19 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 T+RVTKNHRVC CHE+AK IS +VGREIILKDPNRFHHF +G+CSC DF+ Sbjct: 626 TVRVTKNHRVCRFCHESAKAISNIVGREIILKDPNRFHHFRDGLCSCGDFW 676 >ref|XP_010258005.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Nelumbo nucifera] ref|XP_010258006.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Nelumbo nucifera] Length = 663 Score = 90.9 bits (224), Expect = 2e-18 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 TIRVTKN RVCH+CH +AK ISK+V REI+LKDPNRFHHF+NG CSC DF+ Sbjct: 613 TIRVTKNLRVCHNCHYSAKLISKIVEREIVLKDPNRFHHFKNGYCSCGDFW 663 >gb|PON57014.1| DYW domain containing protein [Parasponia andersonii] Length = 665 Score = 89.0 bits (219), Expect = 9e-18 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 TIRVTKN RVC CHE+AK IS++VGREIILKDPNRFHHF NG+CSC D + Sbjct: 615 TIRVTKNLRVCRFCHESAKAISRMVGREIILKDPNRFHHFHNGLCSCTDVW 665 >gb|ATP73680.1| hypothetical protein 2_9455_01, partial [Pinus sylvestris] Length = 156 Score = 83.6 bits (205), Expect = 2e-17 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 +I VTKN RVC CH A K+ISKVVGREII++D NRFHHF+NG+CSC D++ Sbjct: 106 SITVTKNLRVCGDCHRATKFISKVVGREIIMRDANRFHHFKNGLCSCGDYW 156 >ref|XP_004137884.2| PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Cucumis sativus] Length = 665 Score = 88.2 bits (217), Expect = 2e-17 Identities = 37/50 (74%), Positives = 46/50 (92%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDF 282 TIR+TKN RVCHSCHE+AK+ISK+VGREII+KDP FHHF++G CSC++F Sbjct: 615 TIRITKNLRVCHSCHESAKFISKMVGREIIVKDPYVFHHFKDGCCSCENF 664 >ref|XP_008465161.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Cucumis melo] Length = 665 Score = 88.2 bits (217), Expect = 2e-17 Identities = 37/50 (74%), Positives = 46/50 (92%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDF 282 TIR+TKN RVCHSCHE+AK+ISK+VGREII+KDP FHHF++G CSC++F Sbjct: 615 TIRITKNLRVCHSCHESAKFISKMVGREIIVKDPYVFHHFKDGCCSCENF 664 >gb|AFG61376.1| hypothetical protein 0_7614_01, partial [Pinus taeda] Length = 110 Score = 82.0 bits (201), Expect = 2e-17 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -1 Query: 428 IRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 IRV KN RVC CH A K+ISK+VGREII++D NRFHHF+NG+CSC D++ Sbjct: 61 IRVVKNLRVCIDCHTATKFISKIVGREIIVRDANRFHHFKNGLCSCGDYW 110 >gb|AEW07637.1| hypothetical protein 0_7614_01, partial [Pinus radiata] gb|AFG61375.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gb|AFG61377.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gb|AFG61378.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gb|AFG61379.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gb|AFG61380.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gb|AFG61381.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gb|AFG61382.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gb|AFG61383.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gb|AFG61384.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gb|AFG61385.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gb|AFG61386.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gb|AFG61387.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gb|AFG61388.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gb|AFG61389.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gb|AFG61390.1| hypothetical protein 0_7614_01, partial [Pinus taeda] Length = 110 Score = 82.0 bits (201), Expect = 2e-17 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -1 Query: 428 IRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 IRV KN RVC CH A K+ISK+VGREII++D NRFHHF+NG+CSC D++ Sbjct: 61 IRVVKNLRVCIDCHTATKFISKIVGREIIVRDANRFHHFKNGLCSCGDYW 110 >ref|XP_022158739.1| pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Momordica charantia] Length = 665 Score = 87.8 bits (216), Expect = 2e-17 Identities = 37/50 (74%), Positives = 45/50 (90%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDF 282 TI +TKN RVCHSCHE+AK+ISK+VGREII+KDP FHHF++G CSC+DF Sbjct: 615 TICITKNLRVCHSCHESAKFISKIVGREIIVKDPYVFHHFKDGCCSCEDF 664 >ref|XP_021890813.1| putative pentatricopeptide repeat-containing protein At3g23330 [Carica papaya] Length = 477 Score = 87.4 bits (215), Expect = 3e-17 Identities = 37/51 (72%), Positives = 45/51 (88%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 TIRVTKN VC SCH+ +K+ISK+V REI+LKDPNRFHHF+NG CSC+DF+ Sbjct: 427 TIRVTKNLNVCCSCHDFSKFISKMVNREIVLKDPNRFHHFKNGSCSCRDFW 477 >dbj|GAV82594.1| PPR domain-containing protein/DYW_deaminase domain-containing protein [Cephalotus follicularis] Length = 582 Score = 86.7 bits (213), Expect = 6e-17 Identities = 36/50 (72%), Positives = 45/50 (90%) Frame = -1 Query: 428 IRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 IR+TKNHRVC SCH++AK ISK+V REII++D NRFHHF+NG+CSC DF+ Sbjct: 533 IRITKNHRVCFSCHDSAKKISKLVQREIIIRDLNRFHHFKNGLCSCGDFW 582 >gb|ATP73690.1| hypothetical protein 2_9455_01, partial [Pinus sylvestris] Length = 156 Score = 81.6 bits (200), Expect = 8e-17 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 +I VTKN RVC CH A K+ISKVVGREII++D NRFHHF++G+CSC D++ Sbjct: 106 SITVTKNLRVCGDCHRATKFISKVVGREIIMRDANRFHHFKDGLCSCGDYW 156 >gb|AFG65809.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 81.6 bits (200), Expect = 8e-17 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 +I VTKN RVC CH A K+ISKVVGREII++D NRFHHF++G+CSC D++ Sbjct: 106 SITVTKNLRVCGDCHRATKFISKVVGREIIMRDSNRFHHFKDGLCSCGDYW 156 >gb|AFG65804.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gb|AFG65805.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gb|AFG65814.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gb|ATP73681.1| hypothetical protein 2_9455_01, partial [Pinus sylvestris] gb|ATP73682.1| hypothetical protein 2_9455_01, partial [Pinus sylvestris] gb|ATP73683.1| hypothetical protein 2_9455_01, partial [Pinus sylvestris] Length = 156 Score = 81.6 bits (200), Expect = 8e-17 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 +I VTKN RVC CH A K+ISKVVGREII++D NRFHHF++G+CSC D++ Sbjct: 106 SITVTKNLRVCGDCHRATKFISKVVGREIIMRDANRFHHFKDGLCSCGDYW 156 >gb|AEW08424.1| hypothetical protein 2_9455_01, partial [Pinus radiata] gb|AFG65801.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gb|AFG65803.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gb|AFG65808.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gb|AFG65810.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gb|AFG65811.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gb|ATP73686.1| hypothetical protein 2_9455_01, partial [Pinus sylvestris] gb|ATP73687.1| hypothetical protein 2_9455_01, partial [Pinus sylvestris] gb|ATP73688.1| hypothetical protein 2_9455_01, partial [Pinus sylvestris] gb|ATP73689.1| hypothetical protein 2_9455_01, partial [Pinus sylvestris] Length = 156 Score = 81.6 bits (200), Expect = 8e-17 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 +I VTKN RVC CH A K+ISKVVGREII++D NRFHHF++G+CSC D++ Sbjct: 106 SITVTKNLRVCGDCHRATKFISKVVGREIIMRDSNRFHHFKDGLCSCGDYW 156 >ref|XP_007227177.1| pentatricopeptide repeat-containing protein DOT4, chloroplastic [Prunus persica] gb|ONI29728.1| hypothetical protein PRUPE_1G211300 [Prunus persica] Length = 654 Score = 85.5 bits (210), Expect = 1e-16 Identities = 37/51 (72%), Positives = 45/51 (88%) Frame = -1 Query: 431 TIRVTKNHRVCHSCHEAAKYISKVVGREIILKDPNRFHHFENGICSCQDFY 279 TIRVTKN RVC +CH++AK IS++VGREIILKDPN FHHF++G CSC DF+ Sbjct: 604 TIRVTKNLRVCRNCHDSAKIISQMVGREIILKDPNCFHHFKDGYCSCGDFW 654