BLASTX nr result
ID: Chrysanthemum22_contig00051216
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00051216 (397 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023752622.1| uncharacterized protein LOC111900986 [Lactuc... 54 4e-06 >ref|XP_023752622.1| uncharacterized protein LOC111900986 [Lactuca sativa] gb|PLY93936.1| hypothetical protein LSAT_6X4280 [Lactuca sativa] Length = 197 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 389 KSRQVEEAAKMNKNMEKFCENALSIYNVYAKGH 291 K+RQVEE AK N+N+ K C NALSIYNVYAKG+ Sbjct: 165 KTRQVEEVAKKNENVRKLCSNALSIYNVYAKGN 197