BLASTX nr result
ID: Chrysanthemum22_contig00050985
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00050985 (412 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFV29425.1| cysteine-rich-repeat containing protein, partial ... 68 5e-11 gb|AFV29423.1| cysteine-rich-repeat containing protein, partial ... 68 5e-11 gb|AFV29420.1| cysteine-rich-repeat containing protein, partial ... 68 5e-11 gb|AFV29404.1| cysteine-rich-repeat containing protein, partial ... 68 5e-11 gb|AFV29460.1| cysteine-rich-repeat containing protein, partial ... 68 7e-11 gb|AFV29430.1| cysteine-rich-repeat containing protein, partial ... 68 7e-11 gb|AFV29422.1| cysteine-rich-repeat containing protein, partial ... 68 7e-11 gb|AFV29390.1| cysteine-rich-repeat containing protein, partial ... 68 7e-11 gb|AFV29388.1| cysteine-rich-repeat containing protein, partial ... 68 7e-11 gb|AFV29432.1| cysteine-rich-repeat containing protein, partial ... 67 9e-11 gb|AFV29416.1| cysteine-rich-repeat containing protein, partial ... 67 1e-10 gb|AFV29402.1| cysteine-rich-repeat containing protein, partial ... 67 1e-10 gb|AFV29391.1| cysteine-rich-repeat containing protein, partial ... 67 1e-10 gb|AFV29412.1| cysteine-rich-repeat containing protein, partial ... 67 2e-10 ref|XP_022039962.1| cysteine-rich repeat secretory protein 1-lik... 63 4e-09 ref|XP_021974989.1| cysteine-rich repeat secretory protein 38-li... 58 3e-07 ref|XP_021975896.1| cysteine-rich receptor-like protein kinase 1... 54 9e-06 ref|XP_022039959.1| cysteine-rich repeat secretory protein 1-lik... 54 9e-06 >gb|AFV29425.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] Length = 248 Score = 68.2 bits (165), Expect = 5e-11 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 1/104 (0%) Frame = -3 Query: 314 IFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKV-EVNYDLNRDAALSRLVEKMRTPTY 138 +FL+QA I+ N AIAQ S T Q + CRN G + + R++ L L ++ Y Sbjct: 3 LFLLQATINVFNLAIAQTSSSGTQQVYSCRNLGDLGSESLRQQRNSLLDSLTSQLGE-RY 61 Query: 137 IGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYIL 6 GY + ++ +A+ LCPP I + C +C+KKTIPY+L Sbjct: 62 TGYIHTRSTKNKSGEQVHAIVLCPPGIEAEDCGKCVKKTIPYLL 105 >gb|AFV29423.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] Length = 248 Score = 68.2 bits (165), Expect = 5e-11 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 1/104 (0%) Frame = -3 Query: 314 IFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKV-EVNYDLNRDAALSRLVEKMRTPTY 138 +FL+QA I+ N AIAQ S T Q + CRN G + + R++ L L ++ Y Sbjct: 3 LFLLQATINVFNLAIAQTSSSGTQQVYSCRNLGDLGSESLRQQRNSLLDSLTSQLGE-RY 61 Query: 137 IGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYIL 6 GY + ++ +A+ LCPP I + C +C+KKTIPY+L Sbjct: 62 TGYIHTRSTKNKSGEQVHAIVLCPPGIEAEDCGKCVKKTIPYLL 105 >gb|AFV29420.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] gb|AFV29421.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] Length = 248 Score = 68.2 bits (165), Expect = 5e-11 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 1/104 (0%) Frame = -3 Query: 314 IFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKV-EVNYDLNRDAALSRLVEKMRTPTY 138 +FL+QA I+ N AIAQ S T Q + CRN G + + R++ L L ++ Y Sbjct: 3 LFLLQATINVFNLAIAQTSSSGTQQVYSCRNLGDLGSESLRQQRNSLLDSLTSQLGK-RY 61 Query: 137 IGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYIL 6 GY + ++ +A+ LCPP I + C +C+KKTIPY+L Sbjct: 62 TGYIHTRSTKNKSGEQVHAIVLCPPGIEAEDCGKCVKKTIPYLL 105 >gb|AFV29404.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29408.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29409.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29414.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29415.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29428.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] gb|AFV29429.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] gb|AFV29455.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 248 Score = 68.2 bits (165), Expect = 5e-11 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 1/104 (0%) Frame = -3 Query: 314 IFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKV-EVNYDLNRDAALSRLVEKMRTPTY 138 +FL+QA I+ N AIAQ S T Q + CRN G + + R++ L L ++ Y Sbjct: 3 LFLLQATINVFNLAIAQTSSSGTQQVYSCRNLGDLGSESLRQQRNSLLDSLTSQLGK-RY 61 Query: 137 IGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYIL 6 GY + ++ +A+ LCPP I + C +C+KKTIPY+L Sbjct: 62 TGYIHTRSTKNKSGEQVHAIVLCPPGIEAEDCGKCVKKTIPYLL 105 >gb|AFV29460.1| cysteine-rich-repeat containing protein, partial [Senecio vulgaris] Length = 248 Score = 67.8 bits (164), Expect = 7e-11 Identities = 38/104 (36%), Positives = 56/104 (53%), Gaps = 1/104 (0%) Frame = -3 Query: 314 IFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKV-EVNYDLNRDAALSRLVEKMRTPTY 138 +FL+QA I+ N AIAQ S T Q + CRN G + + R++ L L ++ Y Sbjct: 3 LFLLQATINVFNLAIAQTSSSGTQQVYSCRNLGDLGSESLRQQRNSLLDSLTSQLGE-RY 61 Query: 137 IGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYIL 6 GY + ++ +A+ LCPP I + C C+KKTIPY+L Sbjct: 62 TGYIHTRSTKNKSGEQVHAIVLCPPGIEAEDCGRCVKKTIPYLL 105 >gb|AFV29430.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] gb|AFV29431.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] Length = 248 Score = 67.8 bits (164), Expect = 7e-11 Identities = 38/104 (36%), Positives = 56/104 (53%), Gaps = 1/104 (0%) Frame = -3 Query: 314 IFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKV-EVNYDLNRDAALSRLVEKMRTPTY 138 +FL+QA I+ N AIAQ S T Q + CRN G + + R++ L L ++ Y Sbjct: 3 LFLLQATINVFNLAIAQTSSSGTQQVYSCRNLGDLGSESLRQQRNSLLDSLTSQLGE-RY 61 Query: 137 IGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYIL 6 GY + ++ +A+ LCPP I + C C+KKTIPY+L Sbjct: 62 TGYIHTRSTKNKSGEQVHAIVLCPPGIQAEDCGRCVKKTIPYLL 105 >gb|AFV29422.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] gb|AFV29424.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] Length = 248 Score = 67.8 bits (164), Expect = 7e-11 Identities = 38/104 (36%), Positives = 56/104 (53%), Gaps = 1/104 (0%) Frame = -3 Query: 314 IFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKV-EVNYDLNRDAALSRLVEKMRTPTY 138 +FL+QA I+ N AIAQ S T Q + CRN G + + R++ L L ++ Y Sbjct: 3 LFLLQATINVFNLAIAQTSSSGTQQVYSCRNLGDLGSESLRQQRNSLLDSLTSQLGK-RY 61 Query: 137 IGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYIL 6 GY + ++ +A+ LCPP I + C C+KKTIPY+L Sbjct: 62 TGYIHTRSTKNKSGEQVHAIVLCPPGIQAEDCGRCVKKTIPYLL 105 >gb|AFV29390.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29392.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29393.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29394.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29396.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29397.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29398.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29399.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29400.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29401.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29405.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29456.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV29457.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 248 Score = 67.8 bits (164), Expect = 7e-11 Identities = 38/104 (36%), Positives = 55/104 (52%), Gaps = 1/104 (0%) Frame = -3 Query: 314 IFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKV-EVNYDLNRDAALSRLVEKMRTPTY 138 +FL+QA I+ N AIAQ S T Q + CRN G + RD+ L L ++ Y Sbjct: 3 LFLLQATINVFNLAIAQTSSSGTQQVYSCRNLGDFGSESLRQKRDSLLDSLTSQLGE-RY 61 Query: 137 IGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYIL 6 GY + ++ +A+ LCPP I + C C+KKTIPY++ Sbjct: 62 TGYIHTRSTKNKSGEQVHAIILCPPGIEAEDCGRCVKKTIPYLI 105 >gb|AFV29388.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29389.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29406.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29407.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29418.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] gb|AFV29419.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] gb|AFV29426.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] gb|AFV29427.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] gb|AFV29438.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV29440.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV29441.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV29442.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV29443.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV29450.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV29451.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV29454.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV29458.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV29459.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 248 Score = 67.8 bits (164), Expect = 7e-11 Identities = 38/104 (36%), Positives = 56/104 (53%), Gaps = 1/104 (0%) Frame = -3 Query: 314 IFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKV-EVNYDLNRDAALSRLVEKMRTPTY 138 +FL+QA I+ N AIAQ S T Q + CRN G + + R++ L L ++ Y Sbjct: 3 LFLLQATINVFNLAIAQTSSSGTQQVYSCRNLGDLGSESLRQQRNSLLDSLTSQLGE-RY 61 Query: 137 IGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYIL 6 GY + ++ +A+ LCPP I + C C+KKTIPY+L Sbjct: 62 TGYIHTRSTKNKSGEQVHAIVLCPPGIQAEDCGRCVKKTIPYLL 105 >gb|AFV29432.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] gb|AFV29433.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] gb|AFV29436.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] gb|AFV29437.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] gb|AFV29452.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV29453.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 248 Score = 67.4 bits (163), Expect = 9e-11 Identities = 37/104 (35%), Positives = 56/104 (53%), Gaps = 1/104 (0%) Frame = -3 Query: 314 IFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKV-EVNYDLNRDAALSRLVEKMRTPTY 138 +FL+QA I+ N A+AQ S T Q + CRN G + + R++ L L ++ Y Sbjct: 3 LFLLQATINVFNLAVAQTSSSGTQQVYSCRNLGDLGSESLRQQRNSLLDSLTSQLGQ-RY 61 Query: 137 IGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYIL 6 GY + ++ +A+ LCPP I + C C+KKTIPY+L Sbjct: 62 TGYIHTRSTKNKSGEQVHAIVLCPPGIEAEDCGRCVKKTIPYLL 105 >gb|AFV29416.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] Length = 248 Score = 67.0 bits (162), Expect = 1e-10 Identities = 37/104 (35%), Positives = 56/104 (53%), Gaps = 1/104 (0%) Frame = -3 Query: 314 IFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKV-EVNYDLNRDAALSRLVEKMRTPTY 138 +FL+QA ++ N AIAQ S T Q + CRN G + + R++ L L ++ Y Sbjct: 3 LFLLQATLNFFNLAIAQTSSSGTQQVYSCRNLGDLGSESLRQQRNSLLDSLTSQLGE-RY 61 Query: 137 IGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYIL 6 GY + ++ +A+ LCPP I + C C+KKTIPY+L Sbjct: 62 TGYIHTRSTKNKSGEQVHAIVLCPPGIEAEDCGRCVKKTIPYLL 105 >gb|AFV29402.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29403.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29446.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV29447.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 248 Score = 67.0 bits (162), Expect = 1e-10 Identities = 37/104 (35%), Positives = 56/104 (53%), Gaps = 1/104 (0%) Frame = -3 Query: 314 IFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKV-EVNYDLNRDAALSRLVEKMRTPTY 138 +FL+QA ++ N AIAQ S T Q + CRN G + + R++ L L ++ Y Sbjct: 3 LFLLQATLNFFNLAIAQTSSSGTQQVYSCRNLGDLGSESLRQQRNSLLDSLTSQLGE-RY 61 Query: 137 IGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYIL 6 GY + ++ +A+ LCPP I + C C+KKTIPY+L Sbjct: 62 TGYIHTRSTKNKSGEQVHAIVLCPPGIEAEDCGRCVKKTIPYLL 105 >gb|AFV29391.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29395.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29410.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29411.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29417.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29439.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 248 Score = 67.0 bits (162), Expect = 1e-10 Identities = 37/104 (35%), Positives = 56/104 (53%), Gaps = 1/104 (0%) Frame = -3 Query: 314 IFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKV-EVNYDLNRDAALSRLVEKMRTPTY 138 +FL+QA ++ N AIAQ S T Q + CRN G + + R++ L L ++ Y Sbjct: 3 LFLLQATLNFFNLAIAQTSSSGTQQVYSCRNLGDLGSESLRQQRNSLLDSLTSQLGE-RY 61 Query: 137 IGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYIL 6 GY + ++ +A+ LCPP I + C C+KKTIPY+L Sbjct: 62 TGYIHTRSTKNKSGEQVHAIVLCPPGIEAEDCGRCVKKTIPYLL 105 >gb|AFV29412.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29413.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis] gb|AFV29434.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] gb|AFV29435.1| cysteine-rich-repeat containing protein, partial [Senecio chrysanthemifolius] gb|AFV29444.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV29445.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV29448.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV29449.1| cysteine-rich-repeat containing protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 248 Score = 66.6 bits (161), Expect = 2e-10 Identities = 36/104 (34%), Positives = 56/104 (53%), Gaps = 1/104 (0%) Frame = -3 Query: 314 IFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKV-EVNYDLNRDAALSRLVEKMRTPTY 138 +FL+QA ++ N A+AQ S T Q + CRN G + + R++ L L ++ Y Sbjct: 3 LFLLQATLNFFNLAVAQTSSSGTQQVYSCRNLGDLGSESLRQQRNSLLDSLTSQLGE-RY 61 Query: 137 IGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYIL 6 GY + ++ +A+ LCPP I + C C+KKTIPY+L Sbjct: 62 TGYIHTRSTKNKSGEQVHAIVLCPPGIEAEDCGRCVKKTIPYLL 105 >ref|XP_022039962.1| cysteine-rich repeat secretory protein 1-like [Helianthus annuus] gb|OTG23887.1| putative gnk2-like domain-containing protein [Helianthus annuus] Length = 265 Score = 63.2 bits (152), Expect = 4e-09 Identities = 38/111 (34%), Positives = 59/111 (53%) Frame = -3 Query: 341 LEMKSIFLYIFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKVEVNYDLNRDAALSRLV 162 +EMKSI L++F++QAII+G N IAQ P CR NRD+AL +L+ Sbjct: 1 MEMKSIILFLFILQAIINGVNLVIAQ---SPKTDRHVCRGGEFRSNTIQKNRDSALDKLM 57 Query: 161 EKMRTPTYIGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYI 9 ++ +Y G+ Y ++ A ++ +A C N+ CE C+K + YI Sbjct: 58 VLIKNSSYNGF-YHTQSAGKPEEQVSASFFCALNVVKGLCECCLKNVVQYI 107 >ref|XP_021974989.1| cysteine-rich repeat secretory protein 38-like [Helianthus annuus] Length = 293 Score = 58.2 bits (139), Expect = 3e-07 Identities = 45/135 (33%), Positives = 69/135 (51%), Gaps = 1/135 (0%) Frame = -3 Query: 410 NNQDRFIYKK**KREVSQFQSNQLEMKSIFLYIFLVQAIIHGGNFAIAQYSIGPTIQDFR 231 N+Q F + + +S FQS Q+E S+ L + L+QAII N AIAQ I PT Q F+ Sbjct: 19 NSQPLFCFSIIDRYCISSFQS-QMETTSLIL-LMLLQAIIIDINLAIAQKPI-PTQQFFK 75 Query: 230 CRNTGKVEVNYDL-NRDAALSRLVEKMRTPTYIGYCYASEDAAGKADRANAVALCPPNI* 54 C N G + L +RD + L + +Y G+ ++ ++CP NI Sbjct: 76 CSNNGNFSSDNLLKDRDQTFNLLFMQDDVGSYTGWDLQTKGVVWTR------SVCPSNIK 129 Query: 53 VQGCEECIKKTIPYI 9 ++ C C+K T+PY+ Sbjct: 130 LEDCRGCVKNTVPYL 144 >ref|XP_021975896.1| cysteine-rich receptor-like protein kinase 11 [Helianthus annuus] gb|OTG19508.1| putative gnk2-like domain-containing protein [Helianthus annuus] Length = 265 Score = 53.9 bits (128), Expect = 9e-06 Identities = 41/113 (36%), Positives = 54/113 (47%), Gaps = 1/113 (0%) Frame = -3 Query: 341 LEMKSIFLYIFLVQAIIHGGNFAIAQYSIGPTIQDFRCRNTGKVEVNYDL-NRDAALSRL 165 +E KS+ + L+QA I+G N A+ P Q C G + N L +RD AL +L Sbjct: 1 METKSLISLMLLLQAFINGVNPALP-----PGQQSSICSKNGDLNSNELLKSRDVALDKL 55 Query: 164 VEKMRTPTYIGYCYASEDAAGKADRANAVALCPPNI*VQGCEECIKKTIPYIL 6 K P Y G D A ALCPP I +Q C C+K+TIP +L Sbjct: 56 --KNFEPPYTG------DRMTSYQGITAKALCPPKIKMQDCSACVKETIPTLL 100 >ref|XP_022039959.1| cysteine-rich repeat secretory protein 1-like [Helianthus annuus] gb|OTG23882.1| putative gnk2-like domain-containing protein [Helianthus annuus] Length = 272 Score = 53.9 bits (128), Expect = 9e-06 Identities = 36/114 (31%), Positives = 64/114 (56%), Gaps = 4/114 (3%) Frame = -3 Query: 341 LEMKSIFLYIFLVQAIIHGGNFAIAQYSIGPTIQD-FRCRNTGKVEVNYDLNRDAALSRL 165 +EMKS ++F++QAII+G N + AQ +QD CR K +N NRD+A +L Sbjct: 1 MEMKSKISFLFILQAIINGANLSTAQ----NLMQDRHECRGYFK-SINVQKNRDSAFDKL 55 Query: 164 VEKMR--TPTYIGYCYASEDAAGKADRANAVALCPPNI*VQG-CEECIKKTIPY 12 + +++ +Y G+ + ++ ++ +A+ LCPPN + CE C++ + Y Sbjct: 56 IAQLKDSNSSYNGF-HHTQVGDKPEEQVSAIYLCPPNAQSRPICECCLRHVVEY 108