BLASTX nr result
ID: Chrysanthemum22_contig00050964
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00050964 (388 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023737107.1| squamosa promoter-binding-like protein 3 [La... 66 3e-10 >ref|XP_023737107.1| squamosa promoter-binding-like protein 3 [Lactuca sativa] gb|PLY71263.1| hypothetical protein LSAT_5X81161 [Lactuca sativa] Length = 291 Score = 66.2 bits (160), Expect = 3e-10 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = +3 Query: 207 MEWNWDNEVPKSLAVSSHENSEYLGGEDMQRSFSNDIIEEGSVISGEALFGLKLGQ 374 MEWNW+ E+PKSL +SSHEN +D SFS ++EEG+VISGEAL GLKLG+ Sbjct: 1 MEWNWEIEMPKSLPISSHEN------DDHHYSFSG-LVEEGAVISGEALIGLKLGR 49