BLASTX nr result
ID: Chrysanthemum22_contig00050515
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00050515 (822 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI06437.1| CheY-like superfamily [Cynara cardunculus var. sc... 74 2e-13 >gb|KVI06437.1| CheY-like superfamily [Cynara cardunculus var. scolymus] Length = 88 Score = 74.3 bits (181), Expect = 2e-13 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 1 DQVSLTLNGLGLGAADYLMRPISADELLNLWTHISARS 114 DQVSLTLNGLGLG ADYLMRP+SADELLNLWTHI ARS Sbjct: 51 DQVSLTLNGLGLGVADYLMRPVSADELLNLWTHILARS 88