BLASTX nr result
ID: Chrysanthemum22_contig00050353
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00050353 (643 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|APJ35651.1| flower asymmetry transporter ClCYC2d [Chrysanthem... 103 1e-22 gb|AMR68925.1| flower asymmetry transporter CYC2d [Chrysanthemum... 103 1e-22 gb|AIC33053.1| flower asymmetry transporter CYC1 [Chrysanthemum ... 103 1e-22 gb|ACC54348.1| CYCLOIDEA-like 3 [Gerbera hybrid cultivar] 72 2e-11 ref|XP_022012880.1| transcription factor DICHOTOMA-like [Heliant... 59 7e-07 gb|AFV30026.1| RAY1-like protein, partial [Senecio aethnensis] >... 59 8e-07 gb|AFV30067.1| RAY1-like protein, partial [Senecio chrysanthemif... 58 3e-06 gb|AFV30042.1| RAY1-like protein, partial [Senecio aethnensis] >... 58 3e-06 gb|AFV30040.1| RAY1-like protein, partial [Senecio aethnensis] >... 58 3e-06 gb|AFV30035.1| RAY1-like protein, partial [Senecio aethnensis] >... 58 3e-06 gb|AFV30032.1| RAY1-like protein, partial [Senecio aethnensis] >... 58 3e-06 gb|AFV30098.1| RAY1-like protein, partial [Senecio vulgaris] 58 3e-06 gb|ACJ71723.1| CYCLOIDEA-like protein [Senecio vulgaris] >gi|215... 58 3e-06 gb|ACJ71722.1| CYCLOIDEA-like protein [Senecio vulgaris] 58 3e-06 >gb|APJ35651.1| flower asymmetry transporter ClCYC2d [Chrysanthemum lavandulifolium] Length = 321 Score = 103 bits (256), Expect = 1e-22 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -2 Query: 642 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLASNDLNSQIKYTSFLNL 496 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLASNDLNSQIKYTSFLNL Sbjct: 272 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLASNDLNSQIKYTSFLNL 320 >gb|AMR68925.1| flower asymmetry transporter CYC2d [Chrysanthemum x morifolium] Length = 322 Score = 103 bits (256), Expect = 1e-22 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -2 Query: 642 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLASNDLNSQIKYTSFLNL 496 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLASNDLNSQIKYTSFLNL Sbjct: 273 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLASNDLNSQIKYTSFLNL 321 >gb|AIC33053.1| flower asymmetry transporter CYC1 [Chrysanthemum lavandulifolium] Length = 322 Score = 103 bits (256), Expect = 1e-22 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -2 Query: 642 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLASNDLNSQIKYTSFLNL 496 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLASNDLNSQIKYTSFLNL Sbjct: 273 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLASNDLNSQIKYTSFLNL 321 >gb|ACC54348.1| CYCLOIDEA-like 3 [Gerbera hybrid cultivar] Length = 323 Score = 72.4 bits (176), Expect = 2e-11 Identities = 32/50 (64%), Positives = 42/50 (84%) Frame = -2 Query: 642 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLASNDLNSQIKYTSFLNLQ 493 SQ+ Y+D++C+S++E K+SMP S L+GYQHN SNDL +Q KYTSFLNLQ Sbjct: 274 SQSDYNDRTCESVMELKMSMPFSALFGYQHNHLSNDLTTQTKYTSFLNLQ 323 >ref|XP_022012880.1| transcription factor DICHOTOMA-like [Helianthus annuus] gb|ABV26445.1| cycloidea-like 2d protein [Helianthus annuus] gb|OTF96058.1| putative transcription factor DICHOTOMA [Helianthus annuus] Length = 306 Score = 59.3 bits (142), Expect = 7e-07 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = -2 Query: 642 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHN-LASNDLNSQIKYTSFLNL 496 S+ +++++ +SI+E K+ M SSV+YGYQHN L ND +SQIKYTSFLNL Sbjct: 256 SKKEFNERTNESIMEPKIPMSSSVVYGYQHNFLVPNDSSSQIKYTSFLNL 305 >gb|AFV30026.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30027.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30028.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30029.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30034.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30044.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30046.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30050.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30052.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30053.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30054.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30060.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30068.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30070.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30076.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30078.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30079.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30082.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30083.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30086.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30088.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30092.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 320 Score = 59.3 bits (142), Expect = 8e-07 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = -2 Query: 642 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHN-LASNDLNSQIKYTSFLNL 496 SQN + ++ +S ++ KV MPSS+ + YQHN L SNDL+SQIKYTSFLNL Sbjct: 270 SQNELNHRTGESTMDPKVPMPSSMFFAYQHNLLESNDLSSQIKYTSFLNL 319 >gb|AFV30067.1| RAY1-like protein, partial [Senecio chrysanthemifolius] Length = 320 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -2 Query: 642 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLA-SNDLNSQIKYTSFLNL 496 SQN + ++ +S + KV MPSS+ + YQHNL SNDL+SQIKYTSFLNL Sbjct: 270 SQNELNHRTGESTMVPKVPMPSSMFFAYQHNLLESNDLSSQIKYTSFLNL 319 >gb|AFV30042.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30045.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30048.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30055.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30058.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30059.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30062.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30064.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30066.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30069.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30071.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30072.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30074.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30075.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30077.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30084.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30085.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30087.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30089.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30090.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30093.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30094.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30095.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30096.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30097.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 320 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -2 Query: 642 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLA-SNDLNSQIKYTSFLNL 496 SQN + ++ +S + KV MPSS+ + YQHNL SNDL+SQIKYTSFLNL Sbjct: 270 SQNELNHRTGESTMVPKVPMPSSMFFAYQHNLLESNDLSSQIKYTSFLNL 319 >gb|AFV30040.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30041.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30043.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30047.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30049.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30051.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30061.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30063.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30065.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30073.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30091.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 320 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -2 Query: 642 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLA-SNDLNSQIKYTSFLNL 496 SQN + ++ +S + KV MPSS+ + YQHNL SNDL+SQIKYTSFLNL Sbjct: 270 SQNELNHRTGESTMVPKVPMPSSMFFAYQHNLLESNDLSSQIKYTSFLNL 319 >gb|AFV30035.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30037.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30056.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30057.1| RAY1-like protein, partial [Senecio chrysanthemifolius] gb|AFV30080.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gb|AFV30081.1| RAY1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 320 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -2 Query: 642 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLA-SNDLNSQIKYTSFLNL 496 SQN + ++ +S + KV MPSS+ + YQHNL SNDL+SQIKYTSFLNL Sbjct: 270 SQNELNHRTGESTMVPKVPMPSSMFFAYQHNLLESNDLSSQIKYTSFLNL 319 >gb|AFV30032.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30033.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30036.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30038.1| RAY1-like protein, partial [Senecio aethnensis] gb|AFV30039.1| RAY1-like protein, partial [Senecio aethnensis] Length = 320 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -2 Query: 642 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLA-SNDLNSQIKYTSFLNL 496 SQN + ++ +S + KV MPSS+ + YQHNL SNDL+SQIKYTSFLNL Sbjct: 270 SQNELNHRTGESTMVPKVPMPSSMFFAYQHNLLESNDLSSQIKYTSFLNL 319 >gb|AFV30098.1| RAY1-like protein, partial [Senecio vulgaris] Length = 321 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -2 Query: 642 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLA-SNDLNSQIKYTSFLNL 496 SQN + ++ +S + KV MPSS+ + YQHNL SNDL+SQIKYTSFLNL Sbjct: 271 SQNELNHRTGESTMVPKVPMPSSMFFAYQHNLLESNDLSSQIKYTSFLNL 320 >gb|ACJ71723.1| CYCLOIDEA-like protein [Senecio vulgaris] gb|ACJ71724.1| CYCLOIDEA-like protein [Senecio squalidus] Length = 329 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -2 Query: 642 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLA-SNDLNSQIKYTSFLNL 496 SQN + ++ +S + KV MPSS+ + YQHNL SNDL+SQIKYTSFLNL Sbjct: 279 SQNELNHRTGESTMVPKVPMPSSMFFAYQHNLLESNDLSSQIKYTSFLNL 328 >gb|ACJ71722.1| CYCLOIDEA-like protein [Senecio vulgaris] Length = 329 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -2 Query: 642 SQNYYHDKSCKSIVETKVSMPSSVLYGYQHNLA-SNDLNSQIKYTSFLNL 496 SQN + ++ +S + KV MPSS+ + YQHNL SNDL+SQIKYTSFLNL Sbjct: 279 SQNELNHRTGESTMVPKVPMPSSMFFAYQHNLLESNDLSSQIKYTSFLNL 328