BLASTX nr result
ID: Chrysanthemum22_contig00049945
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00049945 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN42487.1| Retrovirus-related Pol polyprotein from transposo... 72 6e-14 gb|KHN25991.1| Retrovirus-related Pol polyprotein from transposo... 72 6e-14 gb|PNX64147.1| retrovirus-related Pol polyprotein from transposo... 71 2e-13 gb|KHN15370.1| Retrovirus-related Pol polyprotein from transposo... 70 3e-13 gb|KHN22845.1| Retrovirus-related Pol polyprotein from transposo... 69 7e-13 ref|XP_021833930.1| uncharacterized protein LOC110773712 [Prunus... 71 9e-13 gb|KHN42250.1| Retrovirus-related Pol polyprotein from transposo... 69 9e-13 ref|XP_014634082.1| PREDICTED: uncharacterized protein LOC106799... 69 2e-12 ref|XP_019107084.1| PREDICTED: uncharacterized protein LOC109135... 68 3e-12 gb|KHN41430.1| Retrovirus-related Pol polyprotein from transposo... 69 4e-12 ref|XP_021769901.1| probable L-type lectin-domain containing rec... 72 5e-12 gb|KHN41558.1| Retrovirus-related Pol polyprotein from transposo... 69 5e-12 gb|KHN35463.1| Retrovirus-related Pol polyprotein from transposo... 69 5e-12 gb|KHN22851.1| Retrovirus-related Pol polyprotein from transposo... 69 5e-12 gb|KHN21247.1| Retrovirus-related Pol polyprotein from transposo... 69 5e-12 gb|KHM99420.1| Retrovirus-related Pol polyprotein from transposo... 69 5e-12 gb|KHN06994.1| Retrovirus-related Pol polyprotein from transposo... 69 7e-12 gb|KHN45809.1| Retrovirus-related Pol polyprotein from transposo... 69 8e-12 gb|KHN45707.1| Retrovirus-related Pol polyprotein from transposo... 69 8e-12 gb|KHN31032.1| Retrovirus-related Pol polyprotein from transposo... 69 8e-12 >gb|KHN42487.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 90 Score = 72.4 bits (176), Expect = 6e-14 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L EIKP +KQE+W LLDR Sbjct: 3 FDGRDFSFWKMQIEDYLYQKKLYQPLSEIKPDDMKQEEWNLLDR 46 >gb|KHN25991.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 90 Score = 72.4 bits (176), Expect = 6e-14 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L EIKP +KQE+W LLDR Sbjct: 3 FDGRDFSFWKMQIEDYLYQKKLYQPLSEIKPEDMKQEEWNLLDR 46 >gb|PNX64147.1| retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Trifolium pratense] Length = 81 Score = 70.9 bits (172), Expect = 2e-13 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L KP +KQEDWALLDR Sbjct: 13 FDGRDFSFWKMQIEDYLYQKKLYQPLSGKKPDDMKQEDWALLDR 56 >gb|KHN15370.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 90 Score = 70.5 bits (171), Expect = 3e-13 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L +KP +KQE+W LLDR Sbjct: 3 FDGRDFSFWKMQIEDYLYQKKLYQPLLGVKPDNMKQEEWNLLDR 46 >gb|KHN22845.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 80 Score = 69.3 bits (168), Expect = 7e-13 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L +KP +KQE+W LLDR Sbjct: 3 FDGRDFSFWKMQIEDYLYQKKLYQPLSGVKPEDMKQEEWNLLDR 46 >ref|XP_021833930.1| uncharacterized protein LOC110773712 [Prunus avium] Length = 146 Score = 70.9 bits (172), Expect = 9e-13 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD DFGFWKM+IEDYLY KKLY+ L E KP G+ EDW LLDR Sbjct: 13 FDGADFGFWKMQIEDYLYQKKLYQPLSENKPEGMNDEDWTLLDR 56 >gb|KHN42250.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 90 Score = 69.3 bits (168), Expect = 9e-13 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L +KP +KQE+W LLDR Sbjct: 3 FDGRDFSFWKMQIEDYLYQKKLYQPLSGVKPDDMKQEEWNLLDR 46 >ref|XP_014634082.1| PREDICTED: uncharacterized protein LOC106799684 [Glycine max] Length = 112 Score = 69.3 bits (168), Expect = 2e-12 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L +KP +KQE+W LLDR Sbjct: 13 FDGRDFSFWKMQIEDYLYQKKLYQPLSGVKPEDMKQEEWNLLDR 56 >ref|XP_019107084.1| PREDICTED: uncharacterized protein LOC109135934 [Beta vulgaris subsp. vulgaris] Length = 100 Score = 68.2 bits (165), Expect = 3e-12 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD +DF FWKM+IEDYLY K LY+ L E KP+ IK EDWA LDR Sbjct: 11 FDGKDFSFWKMQIEDYLYQKDLYQPLSEKKPAAIKDEDWATLDR 54 >gb|KHN41430.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 151 Score = 69.3 bits (168), Expect = 4e-12 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L +KP +KQE+W LLDR Sbjct: 13 FDGRDFSFWKMQIEDYLYQKKLYQPLSGVKPEDMKQEEWNLLDR 56 >ref|XP_021769901.1| probable L-type lectin-domain containing receptor kinase S.5 [Chenopodium quinoa] Length = 576 Score = 72.4 bits (176), Expect = 5e-12 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD DFGFWKM+I+DYLY KKLYE L E KP G+K EDW LLDR Sbjct: 393 FDGADFGFWKMQIKDYLYQKKLYEPLLEKKPEGMKDEDWNLLDR 436 >gb|KHN41558.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 163 Score = 69.3 bits (168), Expect = 5e-12 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L +KP +KQE+W LLDR Sbjct: 13 FDGRDFSFWKMQIEDYLYQKKLYQPLSGVKPEDMKQEEWNLLDR 56 >gb|KHN35463.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 163 Score = 69.3 bits (168), Expect = 5e-12 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L +KP +KQE+W LLDR Sbjct: 13 FDGRDFSFWKMQIEDYLYQKKLYQPLSGVKPEDMKQEEWNLLDR 56 >gb|KHN22851.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 163 Score = 69.3 bits (168), Expect = 5e-12 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L +KP +KQE+W LLDR Sbjct: 13 FDGRDFSFWKMQIEDYLYQKKLYQPLSGVKPEDMKQEEWNLLDR 56 >gb|KHN21247.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 163 Score = 69.3 bits (168), Expect = 5e-12 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L +KP +KQE+W LLDR Sbjct: 13 FDDRDFSFWKMQIEDYLYQKKLYQPLSGVKPEDMKQEEWNLLDR 56 >gb|KHM99420.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 163 Score = 69.3 bits (168), Expect = 5e-12 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L +KP +KQE+W LLDR Sbjct: 13 FDGRDFSFWKMQIEDYLYQKKLYQPLSGVKPEDMKQEEWNLLDR 56 >gb|KHN06994.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 182 Score = 69.3 bits (168), Expect = 7e-12 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L +KP +KQE+W LLDR Sbjct: 13 FDGRDFSFWKMQIEDYLYQKKLYQPLSGVKPEDMKQEEWNLLDR 56 >gb|KHN45809.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 183 Score = 69.3 bits (168), Expect = 8e-12 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L +KP +KQE+W LLDR Sbjct: 13 FDGRDFSFWKMQIEDYLYQKKLYQPLSGVKPEDMKQEEWNLLDR 56 >gb|KHN45707.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 183 Score = 69.3 bits (168), Expect = 8e-12 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L +KP +KQE+W LLDR Sbjct: 13 FDGRDFSFWKMQIEDYLYQKKLYQPLSGVKPEDMKQEEWNLLDR 56 >gb|KHN31032.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 183 Score = 69.3 bits (168), Expect = 8e-12 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 291 FDCRDFGFWKMRIEDYLYPKKLYETLFEIKPSGIKQEDWALLDR 422 FD RDF FWKM+IEDYLY KKLY+ L +KP +KQE+W LLDR Sbjct: 13 FDGRDFSFWKMQIEDYLYQKKLYQPLSGVKPEDMKQEEWNLLDR 56