BLASTX nr result
ID: Chrysanthemum22_contig00049925
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00049925 (468 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH88881.1| F-box associated interaction domain-containing pr... 62 3e-08 ref|XP_023768645.1| F-box/kelch-repeat protein At3g06240-like [L... 60 1e-07 >gb|KVH88881.1| F-box associated interaction domain-containing protein [Cynara cardunculus var. scolymus] Length = 363 Score = 62.0 bits (149), Expect = 3e-08 Identities = 33/86 (38%), Positives = 48/86 (55%), Gaps = 3/86 (3%) Frame = +1 Query: 211 RGNLLFLSKYYTPHSLLLNHHHE---ISRPTNLLFKSHDPYLFTFYGSCNGFVFTSVWYS 381 R +L+F+S ++ +SL +HH + RP L F H +FT YG CNG V S Sbjct: 55 RNHLIFVSYDHSLYSLPFHHHEPAALVPRPKKLRFDLHH-VVFTLYGCCNGLVLVSAHNF 113 Query: 382 YNVHEFVVFNPTTKDFEELPKSGNEL 459 +H V+ NPTT++ ELP+S E+ Sbjct: 114 DGLHSLVILNPTTREIMELPESNYEV 139 >ref|XP_023768645.1| F-box/kelch-repeat protein At3g06240-like [Lactuca sativa] gb|PLY81842.1| hypothetical protein LSAT_3X24620 [Lactuca sativa] Length = 361 Score = 60.5 bits (145), Expect = 1e-07 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 2/87 (2%) Frame = +1 Query: 211 RGNLLFLSKYYTPHSLLLNHHHE--ISRPTNLLFKSHDPYLFTFYGSCNGFVFTSVWYSY 384 R L+F+S + +SL +H + PT +L +S+ F +GSCNG V S Sbjct: 55 RSQLIFVSNHRPLYSLPFHHDEAEAVLEPTKILLESYHTD-FNLHGSCNGLVLVSARTFA 113 Query: 385 NVHEFVVFNPTTKDFEELPKSGNELRN 465 +VH VV NPTTK+F ELP S E+ N Sbjct: 114 SVHVLVVLNPTTKEFVELPASDYEMIN 140