BLASTX nr result
ID: Chrysanthemum22_contig00049916
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00049916 (364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|5EMZ|B Chain B, Crystal Structure Of K48-linked Diubiquitin ... 58 8e-09 ref|XP_009399218.1| PREDICTED: polyubiquitin [Musa acuminata sub... 61 1e-08 emb|CAI83759.1| Polyubiqutin 6, partial [Polyplastron multivesic... 58 1e-08 emb|CAI83753.1| Polyubiqutin 1, partial [Metadinium medium] 58 1e-08 emb|CAI83756.1| Polyubiqutin 3, partial [Polyplastron multivesic... 58 1e-08 ref|WP_103695525.1| hypothetical protein [Pseudomonas syringae] ... 57 2e-08 ref|XP_016825685.1| PREDICTED: ubiquitin-like [Cricetulus griseus] 57 3e-08 gb|ADF45307.1| ubiquitin, partial [Trematomus bernacchii] 56 5e-08 ref|XP_022997484.1| ubiquitin-40S ribosomal protein S27a-like [C... 58 5e-08 gb|ERE80260.1| ubiquitin-60S ribosomal protein L40-like isoform ... 56 5e-08 emb|CAI83750.1| Polyubiqutin 4, partial [Isotricha prostoma] 58 5e-08 emb|CAI77900.1| polyubiquitine protein, partial [Collozoum inerme] 57 5e-08 ref|XP_015055115.1| PREDICTED: ubiquitin-like [Solanum pennellii] 57 6e-08 gb|AAQ08998.1| polyubiquitin 1, partial [Phaseolus vulgaris] 55 6e-08 ref|XP_005845753.1| ubiquitin, partial [Chlorella variabilis] >g... 56 7e-08 gb|AAO38879.1| ubiquitin/ribosomal fusion protein [Malus domestica] 58 7e-08 gb|PBJ74912.1| ubiquitin-like [Trypanosoma cruzi cruzi] 56 7e-08 emb|CAA32691.1| unnamed protein product [Trypanosoma brucei] 56 7e-08 pdb|2M0X|A Chain A, Solution Structure Of U14ub1, An Engineered ... 56 7e-08 gb|AAL77200.1| ubiquitin, partial [Oryza sativa] 55 7e-08 >pdb|5EMZ|B Chain B, Crystal Structure Of K48-linked Diubiquitin With F45w Mutation In The Proximal Unit pdb|5EMZ|D Chain D, Crystal Structure Of K48-linked Diubiquitin With F45w Mutation In The Proximal Unit pdb|5EMZ|F Chain F, Crystal Structure Of K48-linked Diubiquitin With F45w Mutation In The Proximal Unit Length = 76 Score = 58.2 bits (139), Expect = 8e-09 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVKAK+QDK G P +Q LIW GK L+ L++Y+I KESTLH++L Sbjct: 23 IENVKAKIQDKEGIPPDQQRLIWAGKQLEDGRTLSDYNIQKESTLHLVL 71 >ref|XP_009399218.1| PREDICTED: polyubiquitin [Musa acuminata subsp. malaccensis] Length = 230 Score = 60.8 bits (146), Expect = 1e-08 Identities = 32/57 (56%), Positives = 40/57 (70%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL*WRE*GIQ 171 I NVKAKMQDK G P +Q LI+ GK L+ LA+Y IHKESTLH+++ R G+Q Sbjct: 99 IENVKAKMQDKEGIPVDQQRLIFAGKQLEDGRTLADYSIHKESTLHLVMRLRGGGMQ 155 >emb|CAI83759.1| Polyubiqutin 6, partial [Polyplastron multivesiculatum] Length = 81 Score = 57.8 bits (138), Expect = 1e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVKAK+QDK G P +Q LI+ GK L+ N LA+Y+I KESTLH++L Sbjct: 27 IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDNRTLADYNIQKESTLHLVL 75 >emb|CAI83753.1| Polyubiqutin 1, partial [Metadinium medium] Length = 83 Score = 57.8 bits (138), Expect = 1e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVKAK+QDK G P +Q LI+ GK L+ N LA+Y+I KESTLH++L Sbjct: 29 IENVKAKIQDKEGIPPDQQRLIFAGKQLEDNRTLADYNIQKESTLHLVL 77 >emb|CAI83756.1| Polyubiqutin 3, partial [Polyplastron multivesiculatum] Length = 84 Score = 57.8 bits (138), Expect = 1e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVKAK+QDK G P +Q LI+ GK L+ N LA+Y+I KESTLH++L Sbjct: 30 IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDNRTLADYNIQKESTLHLVL 78 >ref|WP_103695525.1| hypothetical protein [Pseudomonas syringae] gb|POP72464.1| hypothetical protein CXB35_02490 [Pseudomonas syringae] Length = 78 Score = 57.0 bits (136), Expect = 2e-08 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 ISNVKAK++DK G P RQ LI+ G+ L+ LA+Y+I KESTLH++L Sbjct: 23 ISNVKAKIEDKTGTPIQRQRLIFAGRQLKDERTLADYNIQKESTLHLVL 71 >ref|XP_016825685.1| PREDICTED: ubiquitin-like [Cricetulus griseus] Length = 77 Score = 56.6 bits (135), Expect = 3e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVKAK+QDK G P +Q LI+ GK L+ IL++Y+I KESTLH+IL Sbjct: 23 IENVKAKIQDKEGIPPDQQRLIFAGKQLEDGCILSDYNIQKESTLHLIL 71 >gb|ADF45307.1| ubiquitin, partial [Trematomus bernacchii] Length = 76 Score = 56.2 bits (134), Expect = 5e-08 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVKAK+QD+ G P +Q LI+ GK L+ L++Y+IHKESTLH++L Sbjct: 23 IENVKAKIQDREGIPPDQQRLIFAGKQLEDGRTLSDYNIHKESTLHLVL 71 >ref|XP_022997484.1| ubiquitin-40S ribosomal protein S27a-like [Cucurbita maxima] Length = 156 Score = 58.2 bits (139), Expect = 5e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVKAK+QDK G P G+Q LI+ GK L+ LA+Y+I KESTLH++L Sbjct: 23 IDNVKAKIQDKEGIPPGQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL 71 >gb|ERE80260.1| ubiquitin-60S ribosomal protein L40-like isoform 2 [Cricetulus griseus] Length = 80 Score = 56.2 bits (134), Expect = 5e-08 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I N KAK+QDK G P +Q LI+ GK L+ +IL++Y+I KESTLH++L Sbjct: 23 IKNAKAKIQDKEGIPPDQQRLIFAGKQLEDGHILSDYNIQKESTLHLVL 71 >emb|CAI83750.1| Polyubiqutin 4, partial [Isotricha prostoma] Length = 143 Score = 57.8 bits (138), Expect = 5e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVKAK+QDK G P +Q LI+ GK L+ N LA+Y+I KESTLH++L Sbjct: 13 IENVKAKIQDKEGIPPDQQRLIFAGKQLEDNRTLADYNIQKESTLHLVL 61 Score = 57.8 bits (138), Expect = 5e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVKAK+QDK G P +Q LI+ GK L+ N LA+Y+I KESTLH++L Sbjct: 89 IENVKAKIQDKEGIPPDQQRLIFAGKQLEDNRTLADYNIQKESTLHLVL 137 >emb|CAI77900.1| polyubiquitine protein, partial [Collozoum inerme] Length = 112 Score = 57.0 bits (136), Expect = 5e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 ISNVKAK+QDK G P +Q LI+ GK L+ LA+Y+I KESTLH++L Sbjct: 23 ISNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL 71 >ref|XP_015055115.1| PREDICTED: ubiquitin-like [Solanum pennellii] Length = 117 Score = 57.0 bits (136), Expect = 6e-08 Identities = 25/49 (51%), Positives = 38/49 (77%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVKAK++DK G P+ +Q L++ GK + +Y LA+Y+I KEST+H++L Sbjct: 23 IDNVKAKIEDKEGIPSDQQRLVYGGKQFKDDYTLADYNIQKESTIHLVL 71 >gb|AAQ08998.1| polyubiquitin 1, partial [Phaseolus vulgaris] Length = 58 Score = 55.5 bits (132), Expect = 6e-08 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVKAK+QDK G P +Q LI+ GK L+ LA+Y+I KESTLH++L Sbjct: 4 IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL 52 >ref|XP_005845753.1| ubiquitin, partial [Chlorella variabilis] gb|EFN53651.1| ubiquitin, partial [Chlorella variabilis] Length = 76 Score = 55.8 bits (133), Expect = 7e-08 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVK+K+QDK G P +Q LI+ GK L+ + LA+Y+I KESTLH++L Sbjct: 23 IENVKSKIQDKEGIPPDQQRLIFAGKQLEDGHTLADYNIQKESTLHLVL 71 >gb|AAO38879.1| ubiquitin/ribosomal fusion protein [Malus domestica] Length = 156 Score = 57.8 bits (138), Expect = 7e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVKAK+QDK G P +Q LI+ GK L+ N LA+Y+I KESTLH++L Sbjct: 23 IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDNRTLADYNIQKESTLHLVL 71 >gb|PBJ74912.1| ubiquitin-like [Trypanosoma cruzi cruzi] Length = 77 Score = 55.8 bits (133), Expect = 7e-08 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVKAK+QDK G P+ +Q L++ GK L+ LA+Y+I KESTLH++L Sbjct: 23 IENVKAKIQDKEGIPSDQQRLVFAGKQLEDGRTLADYNIQKESTLHLVL 71 >emb|CAA32691.1| unnamed protein product [Trypanosoma brucei] Length = 77 Score = 55.8 bits (133), Expect = 7e-08 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVKAK+QDK G P +Q LI+ GK L+ LA+Y+I KESTLH++L Sbjct: 23 IENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVL 71 >pdb|2M0X|A Chain A, Solution Structure Of U14ub1, An Engineered Ubiquitin Variant With Increased Affinity For Usp14 Length = 78 Score = 55.8 bits (133), Expect = 7e-08 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL*WR 156 I NVKAK+QDK G P +Q LI+ GK L+ L++Y+I KESTLH++ WR Sbjct: 25 IENVKAKIQDKTGLPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHIV--WR 74 >gb|AAL77200.1| ubiquitin, partial [Oryza sativa] Length = 64 Score = 55.5 bits (132), Expect = 7e-08 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +1 Query: 1 ISNVKAKMQDKVGRPTGRQYLIWNGKVLQVNYILAEYHIHKESTLHVIL 147 I NVKAK+QDK G P +Q LI+ GK L+ LA+Y+I KESTLH++L Sbjct: 10 IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL 58